Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9MQX2

Protein Details
Accession A0A1L9MQX2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-69DGGKRHRREKLKYRPRVDPVBasic
NLS Segment(s)
PositionSequence
53-63KRHRREKLKYR
Subcellular Location(s) mito 9, extr 8, nucl 6, plas 2
Family & Domain DBs
Amino Acid Sequences MLTFVLGFSFCSLSIFRQLIGMIQSMHQSNTPHSSEATYPGSGYQNTGLDGGKRHRREKLKYRPRVDPVGLGFPASKFPVAGQRFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.16
5 0.16
6 0.16
7 0.16
8 0.15
9 0.1
10 0.1
11 0.12
12 0.12
13 0.13
14 0.13
15 0.13
16 0.14
17 0.19
18 0.19
19 0.18
20 0.17
21 0.18
22 0.17
23 0.2
24 0.2
25 0.15
26 0.14
27 0.14
28 0.15
29 0.14
30 0.14
31 0.11
32 0.09
33 0.1
34 0.1
35 0.09
36 0.09
37 0.11
38 0.17
39 0.24
40 0.29
41 0.32
42 0.39
43 0.47
44 0.56
45 0.64
46 0.69
47 0.72
48 0.77
49 0.8
50 0.81
51 0.78
52 0.77
53 0.67
54 0.62
55 0.55
56 0.51
57 0.45
58 0.37
59 0.32
60 0.25
61 0.26
62 0.21
63 0.18
64 0.12
65 0.13
66 0.22