Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9MT46

Protein Details
Accession A0A1L9MT46   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
271-303ATLPTKKKKLGAPKKLSGKKPPPPSKLKNGLTPHydrophilic
NLS Segment(s)
PositionSequence
276-298KKKKLGAPKKLSGKKPPPPSKLK
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013246  SAGA_su_Sgf11  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF08209  Sgf11  
Amino Acid Sequences MGESNGAEENGSSFPSGTLAKLTCDILNDTFYNIIHDIVAKVHRDEKVSRMRSAVVTARQKADEEASKRREESGKPAGAFKPGDLDLEELKDIHVETDAAVFDEGKVYLKGNPLQTTKEIICPECRLPRLLYPVTGVGARAPPDPYREYCQKQPMINKPGHDVHGNPFATDKLNPKKKKQTNTSNTPASSPPTTPDSSFKQAAPEKVSFPTVKCPNCPRYFVVTRVAQHLDRCLGLSGRQTNRNKTPMENGASTPSSAPPKRPLVDDDVPATLPTKKKKLGAPKKLSGKKPPPPSKLKNGLTPDMAAASDAAGSGDGDIKSEANGDNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.12
4 0.11
5 0.15
6 0.15
7 0.16
8 0.18
9 0.2
10 0.18
11 0.2
12 0.22
13 0.19
14 0.22
15 0.2
16 0.2
17 0.19
18 0.18
19 0.2
20 0.17
21 0.16
22 0.12
23 0.13
24 0.12
25 0.14
26 0.18
27 0.16
28 0.18
29 0.23
30 0.25
31 0.28
32 0.3
33 0.35
34 0.42
35 0.45
36 0.45
37 0.41
38 0.41
39 0.39
40 0.41
41 0.39
42 0.37
43 0.4
44 0.42
45 0.43
46 0.42
47 0.41
48 0.38
49 0.37
50 0.35
51 0.33
52 0.39
53 0.41
54 0.43
55 0.43
56 0.46
57 0.46
58 0.41
59 0.44
60 0.44
61 0.45
62 0.43
63 0.46
64 0.43
65 0.42
66 0.4
67 0.31
68 0.26
69 0.21
70 0.21
71 0.17
72 0.18
73 0.14
74 0.16
75 0.16
76 0.11
77 0.11
78 0.1
79 0.1
80 0.08
81 0.07
82 0.05
83 0.05
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.06
90 0.07
91 0.07
92 0.07
93 0.07
94 0.08
95 0.1
96 0.14
97 0.17
98 0.2
99 0.24
100 0.25
101 0.27
102 0.27
103 0.29
104 0.26
105 0.28
106 0.26
107 0.23
108 0.24
109 0.25
110 0.28
111 0.29
112 0.29
113 0.26
114 0.26
115 0.28
116 0.32
117 0.3
118 0.27
119 0.23
120 0.22
121 0.21
122 0.19
123 0.15
124 0.09
125 0.1
126 0.1
127 0.1
128 0.11
129 0.11
130 0.15
131 0.17
132 0.19
133 0.23
134 0.29
135 0.31
136 0.35
137 0.41
138 0.42
139 0.43
140 0.48
141 0.52
142 0.5
143 0.49
144 0.45
145 0.41
146 0.4
147 0.38
148 0.31
149 0.23
150 0.21
151 0.27
152 0.26
153 0.21
154 0.19
155 0.18
156 0.18
157 0.19
158 0.23
159 0.25
160 0.34
161 0.38
162 0.45
163 0.55
164 0.61
165 0.69
166 0.71
167 0.73
168 0.73
169 0.77
170 0.77
171 0.72
172 0.65
173 0.58
174 0.49
175 0.41
176 0.33
177 0.25
178 0.2
179 0.2
180 0.2
181 0.19
182 0.22
183 0.25
184 0.28
185 0.29
186 0.27
187 0.3
188 0.32
189 0.34
190 0.35
191 0.31
192 0.28
193 0.27
194 0.3
195 0.24
196 0.22
197 0.28
198 0.31
199 0.31
200 0.35
201 0.41
202 0.47
203 0.49
204 0.52
205 0.46
206 0.47
207 0.49
208 0.47
209 0.46
210 0.41
211 0.39
212 0.4
213 0.39
214 0.32
215 0.3
216 0.29
217 0.24
218 0.2
219 0.19
220 0.16
221 0.13
222 0.14
223 0.19
224 0.24
225 0.28
226 0.37
227 0.4
228 0.47
229 0.53
230 0.57
231 0.53
232 0.48
233 0.51
234 0.49
235 0.49
236 0.44
237 0.38
238 0.37
239 0.36
240 0.33
241 0.27
242 0.24
243 0.27
244 0.26
245 0.29
246 0.31
247 0.38
248 0.39
249 0.41
250 0.41
251 0.41
252 0.44
253 0.43
254 0.39
255 0.33
256 0.31
257 0.29
258 0.27
259 0.23
260 0.24
261 0.28
262 0.33
263 0.36
264 0.41
265 0.49
266 0.59
267 0.65
268 0.7
269 0.73
270 0.75
271 0.81
272 0.85
273 0.85
274 0.84
275 0.83
276 0.81
277 0.83
278 0.84
279 0.83
280 0.84
281 0.85
282 0.85
283 0.85
284 0.8
285 0.78
286 0.75
287 0.7
288 0.62
289 0.55
290 0.46
291 0.36
292 0.31
293 0.22
294 0.15
295 0.11
296 0.08
297 0.07
298 0.06
299 0.05
300 0.05
301 0.05
302 0.1
303 0.09
304 0.1
305 0.11
306 0.11
307 0.11
308 0.14