Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9NPM7

Protein Details
Accession A0A1L9NPM7   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
288-313ISAPKKSNTPTGPPKKPKAEPVRARLHydrophilic
NLS Segment(s)
PositionSequence
298-312TGPPKKPKAEPVRAR
Subcellular Location(s) cyto 12, pero 11, cyto_nucl 8.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR044831  Ccp1-like  
IPR002016  Haem_peroxidase  
IPR010255  Haem_peroxidase_sf  
IPR002207  Peroxidase_I  
IPR019794  Peroxidases_AS  
Gene Ontology GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
GO:0004601  F:peroxidase activity  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF00141  peroxidase  
PROSITE View protein in PROSITE  
PS00436  PEROXIDASE_2  
PS50873  PEROXIDASE_4  
CDD cd00691  ascorbate_peroxidase  
Amino Acid Sequences MSSPGDYNAVRKDIVAQLKKPDYDDGSAGPVFVRLAWHSAGTYDAETDTGGSNGAGMRYEAEGGDPSNAGLQYGRAFLEPVKEKHTWITYSDLWTLAGVVAIKEMGGPEVEWKPGRTDLVDDSKVPPRGRLPDGAQGADHLRFIFNRMGFNDQEIVALAGGHNLGRCHTDRSGFEGPWVNNPTRFSNQFFKLLLKLEWTPRKLANGMSQFVYEDPDAEEGDELLMMLPTDIALKTDPSFRQWVEKYAEDKDLFFDHFAKVFAKLVELGIRRDAKGAVLNTDNVKGGYISAPKKSNTPTGPPKKPKAEPVRARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.4
4 0.46
5 0.52
6 0.53
7 0.51
8 0.49
9 0.43
10 0.39
11 0.38
12 0.3
13 0.29
14 0.28
15 0.25
16 0.2
17 0.17
18 0.14
19 0.12
20 0.13
21 0.09
22 0.12
23 0.13
24 0.13
25 0.13
26 0.13
27 0.14
28 0.13
29 0.13
30 0.11
31 0.1
32 0.09
33 0.09
34 0.1
35 0.09
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.07
42 0.07
43 0.06
44 0.07
45 0.08
46 0.09
47 0.08
48 0.08
49 0.09
50 0.09
51 0.1
52 0.09
53 0.08
54 0.1
55 0.1
56 0.09
57 0.08
58 0.09
59 0.09
60 0.1
61 0.11
62 0.09
63 0.09
64 0.1
65 0.18
66 0.22
67 0.23
68 0.27
69 0.28
70 0.28
71 0.32
72 0.36
73 0.29
74 0.25
75 0.29
76 0.26
77 0.28
78 0.28
79 0.24
80 0.2
81 0.18
82 0.16
83 0.11
84 0.09
85 0.06
86 0.05
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.07
96 0.09
97 0.11
98 0.12
99 0.13
100 0.15
101 0.16
102 0.17
103 0.14
104 0.15
105 0.17
106 0.23
107 0.23
108 0.22
109 0.24
110 0.29
111 0.34
112 0.32
113 0.29
114 0.26
115 0.3
116 0.32
117 0.32
118 0.3
119 0.32
120 0.33
121 0.32
122 0.28
123 0.23
124 0.23
125 0.19
126 0.16
127 0.09
128 0.08
129 0.07
130 0.1
131 0.13
132 0.12
133 0.14
134 0.14
135 0.18
136 0.17
137 0.18
138 0.16
139 0.13
140 0.12
141 0.1
142 0.09
143 0.06
144 0.06
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.07
153 0.08
154 0.11
155 0.13
156 0.15
157 0.15
158 0.23
159 0.26
160 0.24
161 0.25
162 0.27
163 0.27
164 0.3
165 0.32
166 0.25
167 0.24
168 0.27
169 0.29
170 0.27
171 0.3
172 0.28
173 0.32
174 0.33
175 0.34
176 0.33
177 0.3
178 0.28
179 0.27
180 0.23
181 0.2
182 0.2
183 0.24
184 0.3
185 0.3
186 0.31
187 0.3
188 0.33
189 0.31
190 0.31
191 0.31
192 0.29
193 0.29
194 0.27
195 0.26
196 0.23
197 0.22
198 0.22
199 0.14
200 0.1
201 0.09
202 0.09
203 0.09
204 0.09
205 0.09
206 0.06
207 0.07
208 0.06
209 0.05
210 0.04
211 0.04
212 0.03
213 0.03
214 0.03
215 0.03
216 0.04
217 0.04
218 0.05
219 0.06
220 0.07
221 0.09
222 0.15
223 0.16
224 0.18
225 0.22
226 0.22
227 0.3
228 0.3
229 0.35
230 0.34
231 0.38
232 0.38
233 0.38
234 0.44
235 0.36
236 0.35
237 0.31
238 0.28
239 0.25
240 0.23
241 0.21
242 0.16
243 0.16
244 0.17
245 0.16
246 0.15
247 0.16
248 0.15
249 0.14
250 0.13
251 0.14
252 0.19
253 0.2
254 0.2
255 0.25
256 0.28
257 0.26
258 0.27
259 0.26
260 0.22
261 0.26
262 0.26
263 0.23
264 0.23
265 0.25
266 0.26
267 0.27
268 0.26
269 0.2
270 0.19
271 0.15
272 0.14
273 0.16
274 0.21
275 0.23
276 0.29
277 0.33
278 0.34
279 0.39
280 0.42
281 0.47
282 0.45
283 0.51
284 0.56
285 0.62
286 0.72
287 0.77
288 0.82
289 0.82
290 0.83
291 0.84
292 0.84
293 0.84