Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9VV90

Protein Details
Accession A0A1L9VV90    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPQKKKWSKVKDKAQHAVVLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 9.5, cyto 8, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPQKKKWSKVKDKAQHAVVLEKSTAEKLNKDVQSYRLITVATLVDRLKINGSLARQALADLEERGVIKKVVGHHDLGIYTRAVAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.8
3 0.73
4 0.63
5 0.58
6 0.49
7 0.41
8 0.31
9 0.24
10 0.21
11 0.19
12 0.21
13 0.17
14 0.16
15 0.18
16 0.27
17 0.28
18 0.29
19 0.29
20 0.28
21 0.32
22 0.33
23 0.29
24 0.22
25 0.2
26 0.18
27 0.17
28 0.15
29 0.09
30 0.09
31 0.08
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.1
38 0.1
39 0.12
40 0.14
41 0.14
42 0.14
43 0.13
44 0.13
45 0.12
46 0.11
47 0.11
48 0.08
49 0.08
50 0.08
51 0.09
52 0.1
53 0.11
54 0.1
55 0.09
56 0.12
57 0.16
58 0.22
59 0.24
60 0.24
61 0.24
62 0.26
63 0.26
64 0.25
65 0.22
66 0.16
67 0.14