Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9V396

Protein Details
Accession A0A1L9V396    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
162-191YYNNNNNNNNNNKKKKKKKTGYALYCRLPLHydrophilic
NLS Segment(s)
PositionSequence
174-180KKKKKKK
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MCQIVLEGGGAKHNLKERVFNTIIWQENQMHLVGYTLEHILSNGLISYNVDEKTAKEALAGHIDKIVLPILHRFNEVPEIEGLQSPRWEDGYLDIFSRDALQQLVTVLAYNKLLEPVRFDIKKVQAAIVKFLRGSPGRADKGMQFHFTEEREKGSSDIQRLYYNNNNNNNNNNKKKKKKKTGYALYCRLPLGSLRARRSDMLKSSPVSDCVPRRNTLNTEHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.35
4 0.34
5 0.41
6 0.42
7 0.39
8 0.39
9 0.4
10 0.42
11 0.36
12 0.38
13 0.3
14 0.3
15 0.31
16 0.25
17 0.18
18 0.14
19 0.13
20 0.1
21 0.09
22 0.09
23 0.08
24 0.08
25 0.07
26 0.07
27 0.07
28 0.07
29 0.06
30 0.05
31 0.05
32 0.05
33 0.06
34 0.08
35 0.1
36 0.11
37 0.12
38 0.12
39 0.12
40 0.17
41 0.18
42 0.16
43 0.13
44 0.14
45 0.15
46 0.23
47 0.23
48 0.18
49 0.18
50 0.19
51 0.18
52 0.17
53 0.16
54 0.08
55 0.08
56 0.13
57 0.15
58 0.16
59 0.17
60 0.16
61 0.16
62 0.22
63 0.21
64 0.18
65 0.15
66 0.15
67 0.15
68 0.16
69 0.16
70 0.11
71 0.12
72 0.11
73 0.11
74 0.1
75 0.1
76 0.09
77 0.1
78 0.13
79 0.13
80 0.13
81 0.12
82 0.11
83 0.11
84 0.12
85 0.09
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.07
100 0.08
101 0.08
102 0.1
103 0.13
104 0.19
105 0.19
106 0.19
107 0.23
108 0.26
109 0.29
110 0.26
111 0.26
112 0.23
113 0.23
114 0.28
115 0.23
116 0.21
117 0.18
118 0.17
119 0.19
120 0.17
121 0.18
122 0.18
123 0.24
124 0.25
125 0.26
126 0.27
127 0.25
128 0.31
129 0.31
130 0.29
131 0.22
132 0.22
133 0.25
134 0.25
135 0.26
136 0.2
137 0.21
138 0.2
139 0.2
140 0.19
141 0.22
142 0.24
143 0.23
144 0.26
145 0.25
146 0.27
147 0.27
148 0.32
149 0.35
150 0.39
151 0.44
152 0.49
153 0.53
154 0.53
155 0.6
156 0.64
157 0.66
158 0.68
159 0.71
160 0.73
161 0.79
162 0.87
163 0.9
164 0.92
165 0.93
166 0.93
167 0.94
168 0.94
169 0.94
170 0.93
171 0.9
172 0.82
173 0.74
174 0.63
175 0.52
176 0.42
177 0.32
178 0.29
179 0.3
180 0.34
181 0.36
182 0.41
183 0.43
184 0.45
185 0.47
186 0.47
187 0.45
188 0.44
189 0.44
190 0.41
191 0.43
192 0.43
193 0.42
194 0.37
195 0.39
196 0.4
197 0.44
198 0.47
199 0.45
200 0.47
201 0.5
202 0.51