Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NGS8

Protein Details
Accession C0NGS8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
38-57VAQKKMKHSRKAVKNDRSYFHydrophilic
NLS Segment(s)
PositionSequence
41-48KKMKHSRK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MSPAFNSLETDGLGMRFPGYNGESIQKKKIKVIVKMEVAQKKMKHSRKAVKNDRSYFPISLLPYQWKVEDVLKISKKPQQVSIFIDKLVSGRMDVIKVPLSRSGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.11
6 0.11
7 0.13
8 0.14
9 0.19
10 0.24
11 0.26
12 0.35
13 0.36
14 0.36
15 0.38
16 0.44
17 0.45
18 0.47
19 0.52
20 0.51
21 0.51
22 0.54
23 0.57
24 0.55
25 0.5
26 0.47
27 0.41
28 0.42
29 0.47
30 0.51
31 0.51
32 0.56
33 0.63
34 0.68
35 0.77
36 0.79
37 0.79
38 0.8
39 0.77
40 0.7
41 0.65
42 0.58
43 0.48
44 0.39
45 0.33
46 0.25
47 0.22
48 0.21
49 0.2
50 0.19
51 0.19
52 0.18
53 0.15
54 0.16
55 0.16
56 0.18
57 0.18
58 0.25
59 0.27
60 0.29
61 0.31
62 0.35
63 0.38
64 0.37
65 0.43
66 0.4
67 0.41
68 0.46
69 0.51
70 0.47
71 0.42
72 0.4
73 0.31
74 0.26
75 0.24
76 0.17
77 0.09
78 0.11
79 0.13
80 0.14
81 0.14
82 0.16
83 0.21
84 0.21
85 0.23