Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VQN1

Protein Details
Accession A0A1L9VQN1   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-38TASPWEPTTPKRPPKRLRPETPGKAIQHydrophilic
NLS Segment(s)
PositionSequence
22-30KRPPKRLRP
Subcellular Location(s) nucl 17, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MGEAPGAHATPTASPWEPTTPKRPPKRLRPETPGKAIQAPPTPKNWQPDRDMPPASPSCETPQIGLAPKPYCSGRDEVLEIVSVMSQKVSNWEEKSLQGAVSLGKDIRALVLNFSRNLATGDPTKEEENHQPSPPMRSSYAGATKTTPNAPQTEPQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.26
4 0.3
5 0.35
6 0.42
7 0.47
8 0.56
9 0.65
10 0.73
11 0.75
12 0.81
13 0.88
14 0.89
15 0.89
16 0.88
17 0.89
18 0.86
19 0.84
20 0.77
21 0.68
22 0.63
23 0.56
24 0.52
25 0.49
26 0.46
27 0.41
28 0.42
29 0.44
30 0.43
31 0.49
32 0.49
33 0.46
34 0.47
35 0.54
36 0.55
37 0.56
38 0.54
39 0.46
40 0.46
41 0.43
42 0.39
43 0.31
44 0.26
45 0.23
46 0.26
47 0.26
48 0.2
49 0.2
50 0.2
51 0.2
52 0.2
53 0.2
54 0.17
55 0.17
56 0.18
57 0.17
58 0.16
59 0.16
60 0.18
61 0.15
62 0.16
63 0.16
64 0.14
65 0.14
66 0.12
67 0.1
68 0.08
69 0.07
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.09
76 0.1
77 0.14
78 0.15
79 0.18
80 0.19
81 0.19
82 0.22
83 0.18
84 0.16
85 0.12
86 0.11
87 0.1
88 0.09
89 0.1
90 0.07
91 0.07
92 0.07
93 0.07
94 0.08
95 0.1
96 0.09
97 0.11
98 0.16
99 0.18
100 0.18
101 0.19
102 0.18
103 0.16
104 0.17
105 0.15
106 0.14
107 0.15
108 0.17
109 0.19
110 0.21
111 0.22
112 0.22
113 0.25
114 0.32
115 0.34
116 0.36
117 0.35
118 0.38
119 0.38
120 0.43
121 0.43
122 0.38
123 0.33
124 0.32
125 0.32
126 0.35
127 0.41
128 0.37
129 0.35
130 0.33
131 0.35
132 0.36
133 0.38
134 0.35
135 0.3
136 0.33
137 0.34