Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9V6F0

Protein Details
Accession A0A1L9V6F0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-93EQDSAATTPKKRRRPRPSQAKRRRFARRNEBasic
NLS Segment(s)
PositionSequence
72-93PKKRRRPRPSQAKRRRFARRNE
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MAIPYCAGDNDLNCVEADVVFHNQLEIQANHDEGKASQRGPISDTITPTSKATTSQLEQPSPPEQDSAATTPKKRRRPRPSQAKRRRFARRNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.12
4 0.12
5 0.09
6 0.11
7 0.11
8 0.11
9 0.1
10 0.1
11 0.11
12 0.14
13 0.12
14 0.13
15 0.13
16 0.14
17 0.15
18 0.15
19 0.14
20 0.11
21 0.15
22 0.13
23 0.13
24 0.15
25 0.15
26 0.16
27 0.17
28 0.2
29 0.19
30 0.18
31 0.2
32 0.19
33 0.19
34 0.2
35 0.18
36 0.16
37 0.12
38 0.12
39 0.13
40 0.14
41 0.14
42 0.2
43 0.24
44 0.24
45 0.24
46 0.26
47 0.28
48 0.27
49 0.26
50 0.19
51 0.16
52 0.16
53 0.19
54 0.19
55 0.22
56 0.24
57 0.28
58 0.37
59 0.46
60 0.55
61 0.63
62 0.71
63 0.75
64 0.82
65 0.89
66 0.91
67 0.93
68 0.94
69 0.96
70 0.95
71 0.93
72 0.92
73 0.92