Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9VX75

Protein Details
Accession A0A1L9VX75    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
3-49LAKKHVPIVKKRTKTFWRHQSDRFKCVPSSWRKPKGIDNRVRRRFKSHydrophilic
NLS Segment(s)
PositionSequence
36-37PK
42-45RVRR
Subcellular Location(s) mito 24.5, mito_nucl 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVLAKKHVPIVKKRTKTFWRHQSDRFKCVPSSWRKPKGIDNRVRRRFKSNLPMPSIGYGSNKKTKHMMPSGHKAFLVHNPRDVELLLMHNRTYAAEIAHAVSSRKRVDILTKAKALGVKVTNPKGRVTTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.8
4 0.81
5 0.81
6 0.81
7 0.79
8 0.83
9 0.85
10 0.81
11 0.79
12 0.73
13 0.65
14 0.56
15 0.53
16 0.53
17 0.52
18 0.56
19 0.59
20 0.64
21 0.64
22 0.66
23 0.72
24 0.73
25 0.74
26 0.73
27 0.73
28 0.75
29 0.81
30 0.86
31 0.79
32 0.74
33 0.69
34 0.68
35 0.68
36 0.64
37 0.62
38 0.6
39 0.59
40 0.52
41 0.48
42 0.4
43 0.3
44 0.26
45 0.21
46 0.2
47 0.26
48 0.25
49 0.25
50 0.28
51 0.29
52 0.32
53 0.35
54 0.38
55 0.37
56 0.46
57 0.48
58 0.45
59 0.43
60 0.37
61 0.33
62 0.34
63 0.36
64 0.27
65 0.28
66 0.28
67 0.28
68 0.29
69 0.27
70 0.19
71 0.13
72 0.16
73 0.14
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.13
80 0.1
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.12
89 0.17
90 0.18
91 0.18
92 0.18
93 0.19
94 0.25
95 0.34
96 0.4
97 0.41
98 0.42
99 0.42
100 0.42
101 0.43
102 0.37
103 0.34
104 0.29
105 0.3
106 0.36
107 0.44
108 0.48
109 0.48
110 0.5
111 0.47