Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9VBS1

Protein Details
Accession A0A1L9VBS1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MKDEVDGEKRRRERKRQEECETLGBasic
NLS Segment(s)
PositionSequence
10-15RRRERK
Subcellular Location(s) plas 8, nucl 6, cyto 4, mito 3, extr 2, E.R. 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKDEVDGEKRRRERKRQEECETLGPLNDEPSFEGRFRSDSAQGFCCVVGCCGLLSVLGIVCFASEAESVSISLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.87
3 0.88
4 0.88
5 0.86
6 0.8
7 0.74
8 0.66
9 0.55
10 0.44
11 0.35
12 0.27
13 0.22
14 0.18
15 0.12
16 0.1
17 0.13
18 0.14
19 0.13
20 0.14
21 0.12
22 0.13
23 0.14
24 0.15
25 0.16
26 0.17
27 0.2
28 0.2
29 0.2
30 0.19
31 0.18
32 0.16
33 0.13
34 0.11
35 0.09
36 0.07
37 0.07
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.07
53 0.08
54 0.08