Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VJ73

Protein Details
Accession A0A1L9VJ73   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
97-133AATKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKDBasic
NLS Segment(s)
PositionSequence
97-133AATKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKD
Subcellular Location(s) mito 20, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAPVTLRTRKFIRNPLLARRQMVVDVLHPNRANVSKDELRDKLSGLYKANKDEVSVFGFRTQYGGGKSTGFALVYDSTEALKKFEPHHRLVRIGAATKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.66
4 0.71
5 0.76
6 0.72
7 0.66
8 0.58
9 0.5
10 0.41
11 0.37
12 0.27
13 0.21
14 0.25
15 0.24
16 0.28
17 0.27
18 0.26
19 0.28
20 0.3
21 0.29
22 0.22
23 0.29
24 0.27
25 0.3
26 0.36
27 0.34
28 0.34
29 0.32
30 0.31
31 0.29
32 0.28
33 0.28
34 0.26
35 0.31
36 0.29
37 0.31
38 0.33
39 0.28
40 0.25
41 0.23
42 0.22
43 0.19
44 0.17
45 0.15
46 0.14
47 0.15
48 0.14
49 0.14
50 0.12
51 0.1
52 0.1
53 0.11
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.08
62 0.08
63 0.08
64 0.08
65 0.07
66 0.07
67 0.09
68 0.09
69 0.09
70 0.1
71 0.12
72 0.16
73 0.25
74 0.3
75 0.34
76 0.42
77 0.43
78 0.44
79 0.42
80 0.43
81 0.37
82 0.33
83 0.29
84 0.25
85 0.23
86 0.22
87 0.24
88 0.2
89 0.2
90 0.26
91 0.35
92 0.42
93 0.51
94 0.6
95 0.68
96 0.79
97 0.87
98 0.91
99 0.92
100 0.93
101 0.94
102 0.95
103 0.95
104 0.94
105 0.94
106 0.92
107 0.91
108 0.88
109 0.87
110 0.87
111 0.87
112 0.84
113 0.85