Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NCG5

Protein Details
Accession C0NCG5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-77AGSHKSQKKQPKSKSERLSGHydrophilic
92-113DPPTSKHKCIKRWVAPARQRDGHydrophilic
NLS Segment(s)
PositionSequence
61-70HKSQKKQPKS
Subcellular Location(s) mito 19, nucl 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MMLHMSTTKGLRVLPAVARIEEDRLHGEFLLPYIYVLFSWIKKFACRGGPRGEGKDEAGSHKSQKKQPKSKSERLSGWMNGWEECGERRGLDPPTSKHKCIKRWVAPARQRDGVQSRRVIKDNYPGFLVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.25
4 0.23
5 0.25
6 0.25
7 0.25
8 0.22
9 0.22
10 0.18
11 0.18
12 0.18
13 0.16
14 0.16
15 0.13
16 0.13
17 0.12
18 0.08
19 0.07
20 0.07
21 0.07
22 0.06
23 0.08
24 0.09
25 0.09
26 0.11
27 0.14
28 0.15
29 0.16
30 0.17
31 0.2
32 0.27
33 0.29
34 0.32
35 0.35
36 0.42
37 0.44
38 0.45
39 0.42
40 0.35
41 0.32
42 0.31
43 0.25
44 0.21
45 0.2
46 0.18
47 0.21
48 0.25
49 0.3
50 0.33
51 0.42
52 0.49
53 0.57
54 0.64
55 0.71
56 0.75
57 0.79
58 0.8
59 0.77
60 0.7
61 0.64
62 0.6
63 0.5
64 0.42
65 0.37
66 0.3
67 0.24
68 0.21
69 0.17
70 0.13
71 0.13
72 0.13
73 0.09
74 0.09
75 0.1
76 0.14
77 0.16
78 0.21
79 0.25
80 0.28
81 0.38
82 0.43
83 0.45
84 0.49
85 0.54
86 0.56
87 0.61
88 0.68
89 0.66
90 0.71
91 0.78
92 0.81
93 0.81
94 0.82
95 0.78
96 0.72
97 0.64
98 0.61
99 0.61
100 0.57
101 0.56
102 0.55
103 0.56
104 0.56
105 0.6
106 0.56
107 0.51
108 0.54
109 0.52
110 0.47