Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VIU4

Protein Details
Accession A0A1L9VIU4   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-110KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 11.833, nucl 7, cyto_nucl 5.833, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MMSLRSLLGASTGTLRQFLPQSLSRPTFFSRSFSRLSLANGLRSLRLRSEQKQMQAGVGAVGARQIEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.16
5 0.17
6 0.19
7 0.22
8 0.25
9 0.31
10 0.34
11 0.32
12 0.34
13 0.35
14 0.36
15 0.32
16 0.33
17 0.31
18 0.32
19 0.34
20 0.31
21 0.3
22 0.25
23 0.27
24 0.3
25 0.26
26 0.24
27 0.23
28 0.22
29 0.23
30 0.22
31 0.21
32 0.15
33 0.2
34 0.23
35 0.24
36 0.33
37 0.34
38 0.36
39 0.38
40 0.37
41 0.31
42 0.27
43 0.23
44 0.15
45 0.11
46 0.08
47 0.04
48 0.05
49 0.05
50 0.04
51 0.05
52 0.05
53 0.06
54 0.09
55 0.12
56 0.13
57 0.16
58 0.17
59 0.17
60 0.21
61 0.3
62 0.32
63 0.37
64 0.39
65 0.41
66 0.48
67 0.51
68 0.51
69 0.5
70 0.52
71 0.54
72 0.6
73 0.64
74 0.66
75 0.73
76 0.78
77 0.77
78 0.79
79 0.8
80 0.79
81 0.78
82 0.78
83 0.76
84 0.77
85 0.79
86 0.75
87 0.75
88 0.77
89 0.81
90 0.82