Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VNN4

Protein Details
Accession A0A1L9VNN4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKTTTRKTKPRVERKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
8-27TRKTKPRVERKKKDPNAPKR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTTRKTKPRVERKKKDPNAPKRGLSAYMFFANDNREKVREENPGISFGQVGKMLGEKWKALSDTDRKPYEEKAATDKKRYEEEKEKYNVCPAMAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.91
4 0.91
5 0.94
6 0.92
7 0.92
8 0.91
9 0.91
10 0.9
11 0.86
12 0.78
13 0.7
14 0.64
15 0.57
16 0.48
17 0.39
18 0.31
19 0.27
20 0.25
21 0.2
22 0.19
23 0.19
24 0.2
25 0.2
26 0.18
27 0.17
28 0.19
29 0.21
30 0.25
31 0.27
32 0.27
33 0.3
34 0.29
35 0.3
36 0.28
37 0.25
38 0.21
39 0.14
40 0.13
41 0.09
42 0.08
43 0.06
44 0.07
45 0.07
46 0.1
47 0.11
48 0.1
49 0.11
50 0.13
51 0.13
52 0.14
53 0.2
54 0.25
55 0.31
56 0.39
57 0.4
58 0.4
59 0.41
60 0.43
61 0.44
62 0.42
63 0.37
64 0.38
65 0.46
66 0.49
67 0.55
68 0.56
69 0.52
70 0.56
71 0.57
72 0.57
73 0.57
74 0.59
75 0.61
76 0.63
77 0.62
78 0.56
79 0.59
80 0.52