Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VF67

Protein Details
Accession A0A1L9VF67   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
87-109VEKGSRSRPRYRDEPRRPSRVYMBasic
NLS Segment(s)
PositionSequence
72-77RRRRRR
Subcellular Location(s) extr 16, plas 8, mito 1, cyto 1, E.R. 1, cyto_mito 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPVLARQSSDSGDTCPSTISGGGIAGIVIGSIAGTLLLIWLWKVCNLKGAWSGGESDVGYVPGAGAETGGRRRRRRTSSPSVVEYVEKGSRSRPRYRDEPRRPSRVYMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.16
5 0.14
6 0.13
7 0.11
8 0.08
9 0.07
10 0.07
11 0.06
12 0.06
13 0.04
14 0.04
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.04
30 0.06
31 0.08
32 0.08
33 0.13
34 0.13
35 0.16
36 0.17
37 0.18
38 0.16
39 0.15
40 0.16
41 0.11
42 0.12
43 0.09
44 0.07
45 0.07
46 0.06
47 0.06
48 0.05
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.05
56 0.12
57 0.19
58 0.27
59 0.32
60 0.39
61 0.49
62 0.57
63 0.64
64 0.67
65 0.72
66 0.75
67 0.76
68 0.73
69 0.66
70 0.59
71 0.5
72 0.41
73 0.35
74 0.27
75 0.22
76 0.19
77 0.24
78 0.31
79 0.37
80 0.45
81 0.48
82 0.52
83 0.62
84 0.72
85 0.76
86 0.79
87 0.84
88 0.83
89 0.86
90 0.83