Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9VIN2

Protein Details
Accession A0A1L9VIN2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
100-123RLRTRGGRKILMRRRQRGKKALSWBasic
NLS Segment(s)
PositionSequence
87-120SRRVQKRRHGFLARLRTRGGRKILMRRRQRGKKA
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFSRRTLPALRTLRAQTPLTTLNRPFSSLLTSRPSLPTTTITLTSTLSPLLSPLTSTLQSPIQSQLQSRQFSASASLAGKRITFNPSRRVQKRRHGFLARLRTRGGRKILMRRRQRGKKALSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.36
4 0.34
5 0.39
6 0.37
7 0.39
8 0.36
9 0.37
10 0.36
11 0.37
12 0.34
13 0.28
14 0.29
15 0.25
16 0.27
17 0.26
18 0.26
19 0.26
20 0.27
21 0.28
22 0.23
23 0.23
24 0.22
25 0.19
26 0.2
27 0.2
28 0.18
29 0.18
30 0.17
31 0.16
32 0.14
33 0.11
34 0.09
35 0.07
36 0.07
37 0.07
38 0.06
39 0.05
40 0.06
41 0.08
42 0.09
43 0.09
44 0.1
45 0.11
46 0.12
47 0.13
48 0.14
49 0.14
50 0.14
51 0.14
52 0.2
53 0.25
54 0.25
55 0.25
56 0.24
57 0.22
58 0.21
59 0.23
60 0.16
61 0.12
62 0.11
63 0.12
64 0.12
65 0.12
66 0.12
67 0.11
68 0.13
69 0.16
70 0.22
71 0.26
72 0.33
73 0.41
74 0.51
75 0.58
76 0.64
77 0.67
78 0.71
79 0.77
80 0.77
81 0.78
82 0.74
83 0.73
84 0.75
85 0.78
86 0.73
87 0.65
88 0.59
89 0.57
90 0.56
91 0.56
92 0.53
93 0.49
94 0.52
95 0.6
96 0.68
97 0.71
98 0.76
99 0.79
100 0.84
101 0.87
102 0.89
103 0.88