Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NIK4

Protein Details
Accession C0NIK4   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
2-22NDNLHRYQHRHQHHNRTIQNRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MNDNLHRYQHRHQHHNRTIQNRVRSIQKENAKGCITKLLEEPEGSMYIKVESKRNLRKDRDGENDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.81
4 0.79
5 0.79
6 0.76
7 0.74
8 0.66
9 0.6
10 0.58
11 0.53
12 0.52
13 0.51
14 0.5
15 0.51
16 0.48
17 0.51
18 0.44
19 0.41
20 0.36
21 0.34
22 0.28
23 0.22
24 0.23
25 0.2
26 0.2
27 0.2
28 0.2
29 0.15
30 0.16
31 0.15
32 0.13
33 0.1
34 0.11
35 0.14
36 0.15
37 0.19
38 0.24
39 0.34
40 0.43
41 0.53
42 0.61
43 0.65
44 0.74
45 0.76
46 0.79