Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9VHZ2

Protein Details
Accession A0A1L9VHZ2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-44TPTASPREPTTPKRPPKRPRPETPGKDIQAHydrophilic
NLS Segment(s)
PositionSequence
26-36PKRPPKRPRPE
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSDVNMGEAPGAHETPTASPREPTTPKRPPKRPRPETPGKDIQAPPTPKNWQPDRDTPPASPSYEAPQSQLGLELQSHIAAAVATRTAEIKSTGEEVLELASAVSQKVTNWEEKGLQGAASLGRDIRSLVLNFSKSLATRIPTKENKNHQPPSKHNSYAEVMRTSPNTPKTHPKPPKTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.19
4 0.21
5 0.19
6 0.21
7 0.24
8 0.32
9 0.37
10 0.42
11 0.48
12 0.55
13 0.64
14 0.73
15 0.81
16 0.83
17 0.87
18 0.91
19 0.9
20 0.9
21 0.9
22 0.9
23 0.86
24 0.85
25 0.83
26 0.73
27 0.71
28 0.62
29 0.58
30 0.55
31 0.53
32 0.46
33 0.43
34 0.46
35 0.43
36 0.5
37 0.5
38 0.48
39 0.5
40 0.57
41 0.58
42 0.6
43 0.59
44 0.51
45 0.49
46 0.45
47 0.4
48 0.32
49 0.26
50 0.23
51 0.25
52 0.24
53 0.21
54 0.2
55 0.19
56 0.18
57 0.18
58 0.13
59 0.09
60 0.09
61 0.08
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.05
76 0.06
77 0.06
78 0.07
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.06
85 0.06
86 0.05
87 0.03
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.09
95 0.11
96 0.13
97 0.14
98 0.16
99 0.16
100 0.16
101 0.18
102 0.14
103 0.12
104 0.1
105 0.09
106 0.09
107 0.08
108 0.08
109 0.07
110 0.07
111 0.07
112 0.07
113 0.08
114 0.1
115 0.1
116 0.13
117 0.16
118 0.17
119 0.17
120 0.18
121 0.18
122 0.16
123 0.18
124 0.18
125 0.16
126 0.22
127 0.26
128 0.34
129 0.4
130 0.48
131 0.55
132 0.62
133 0.71
134 0.74
135 0.79
136 0.78
137 0.8
138 0.8
139 0.79
140 0.78
141 0.72
142 0.63
143 0.59
144 0.55
145 0.52
146 0.49
147 0.43
148 0.35
149 0.34
150 0.35
151 0.33
152 0.36
153 0.38
154 0.38
155 0.4
156 0.5
157 0.54
158 0.63
159 0.7