Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VS94

Protein Details
Accession A0A1L9VS94    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-101PAPAPEKKRGRPRVKNVAPKGBasic
128-152ENNGGAPKKPSHRRRKPASTATTTAHydrophilic
NLS Segment(s)
PositionSequence
82-97APAPEKKRGRPRVKNV
134-144PKKPSHRRRKP
Subcellular Location(s) nucl 20, cyto_nucl 13.5, mito 4
Family & Domain DBs
Amino Acid Sequences MSSTDEISTNDNQFIIECLKNLDEDRLINLNKVAETLGYSNIFSAGNRLRSLRNRYGFANFEGKTITGKAVAGEGAGIPAPAPAPEKKRGRPRVKNVAPKGDIAVEVTNKRKRDDDSNNNNNNNNNEENNGGAPKKPSHRRRKPASTATTTAESEATTNGLGHVHGPAGGNDDNNNSGQEEAGYAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.15
4 0.14
5 0.15
6 0.16
7 0.18
8 0.19
9 0.2
10 0.17
11 0.17
12 0.21
13 0.24
14 0.25
15 0.24
16 0.24
17 0.22
18 0.2
19 0.2
20 0.16
21 0.1
22 0.11
23 0.11
24 0.13
25 0.12
26 0.12
27 0.12
28 0.13
29 0.13
30 0.1
31 0.15
32 0.16
33 0.18
34 0.2
35 0.21
36 0.26
37 0.34
38 0.42
39 0.46
40 0.45
41 0.45
42 0.46
43 0.49
44 0.46
45 0.41
46 0.4
47 0.31
48 0.28
49 0.26
50 0.24
51 0.2
52 0.18
53 0.16
54 0.09
55 0.08
56 0.08
57 0.08
58 0.07
59 0.06
60 0.05
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.06
70 0.09
71 0.13
72 0.22
73 0.27
74 0.34
75 0.44
76 0.54
77 0.63
78 0.7
79 0.74
80 0.78
81 0.81
82 0.84
83 0.77
84 0.75
85 0.66
86 0.57
87 0.49
88 0.38
89 0.3
90 0.21
91 0.18
92 0.12
93 0.14
94 0.2
95 0.24
96 0.24
97 0.25
98 0.27
99 0.28
100 0.36
101 0.43
102 0.48
103 0.54
104 0.64
105 0.7
106 0.7
107 0.69
108 0.62
109 0.54
110 0.47
111 0.39
112 0.29
113 0.23
114 0.21
115 0.19
116 0.18
117 0.18
118 0.15
119 0.14
120 0.16
121 0.19
122 0.28
123 0.37
124 0.47
125 0.56
126 0.66
127 0.75
128 0.82
129 0.88
130 0.89
131 0.89
132 0.87
133 0.83
134 0.75
135 0.69
136 0.62
137 0.52
138 0.43
139 0.33
140 0.25
141 0.18
142 0.15
143 0.12
144 0.08
145 0.08
146 0.08
147 0.08
148 0.07
149 0.07
150 0.08
151 0.07
152 0.08
153 0.09
154 0.09
155 0.13
156 0.14
157 0.15
158 0.15
159 0.18
160 0.18
161 0.18
162 0.19
163 0.15
164 0.14
165 0.13
166 0.12