Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9VKK6

Protein Details
Accession A0A1L9VKK6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-24SLHPLKHLARHNPKALRQQFRNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR011761  ATP-grasp  
IPR013650  ATP-grasp_succ-CoA_synth-type  
IPR013815  ATP_grasp_subdomain_1  
IPR005811  CoA_ligase  
IPR017866  Succ-CoA_synthase_bsu_CS  
IPR005809  Succ_CoA_synthase_bsu  
IPR016102  Succinyl-CoA_synth-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0016874  F:ligase activity  
GO:0046872  F:metal ion binding  
GO:0006099  P:tricarboxylic acid cycle  
Pfam View protein in Pfam  
PF08442  ATP-grasp_2  
PF00549  Ligase_CoA  
PROSITE View protein in PROSITE  
PS50975  ATP_GRASP  
PS01217  SUCCINYL_COA_LIG_3  
Amino Acid Sequences MLSLHPLKHLARHNPKALRQQFRNLTLLEHHSHKLLQQYDIPVPDGYVVDNPLDAKAVVTKIGKPSMLKSQILAGGRGKGKFDTDGKGGVRMVSTPHEAFTNATNMLGHYLKTKQTPPAGLLVKKLYIYKAVDVVHEYYFSITFDRQKSSPVILISDEGGVNVEANSDKLHRFWFSLSEGIMPKIIADIRSRLLFSRTEMPVIEHIIRQMVELFNAKDAILLELNPLALTSEGKFICLDAKFDFDNSAQFKQEDLWELEEQTPDSENEHDASKNGLVYIRQGGNIGNIVNGAGLAMATSDLINIHGGKSANFLDIGGKATTSTLLKAFEILARDSRVQGIWINIFGGIVRCDMIAKSILQAASSMGGFRIPVVVRLQGTNSESALKMLETSGLNLHTETDFELAATSIIKLASGGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.78
3 0.81
4 0.82
5 0.81
6 0.76
7 0.78
8 0.77
9 0.74
10 0.7
11 0.6
12 0.53
13 0.48
14 0.48
15 0.42
16 0.37
17 0.33
18 0.31
19 0.31
20 0.31
21 0.34
22 0.3
23 0.3
24 0.3
25 0.34
26 0.36
27 0.37
28 0.37
29 0.29
30 0.26
31 0.24
32 0.2
33 0.16
34 0.13
35 0.13
36 0.11
37 0.12
38 0.12
39 0.11
40 0.12
41 0.1
42 0.09
43 0.11
44 0.12
45 0.15
46 0.16
47 0.2
48 0.24
49 0.27
50 0.29
51 0.27
52 0.3
53 0.36
54 0.4
55 0.37
56 0.32
57 0.33
58 0.36
59 0.36
60 0.35
61 0.26
62 0.27
63 0.3
64 0.31
65 0.28
66 0.24
67 0.25
68 0.27
69 0.28
70 0.26
71 0.25
72 0.29
73 0.29
74 0.3
75 0.29
76 0.25
77 0.22
78 0.18
79 0.18
80 0.15
81 0.19
82 0.17
83 0.17
84 0.17
85 0.17
86 0.17
87 0.17
88 0.17
89 0.13
90 0.13
91 0.13
92 0.12
93 0.14
94 0.14
95 0.12
96 0.12
97 0.15
98 0.17
99 0.21
100 0.24
101 0.27
102 0.3
103 0.32
104 0.3
105 0.35
106 0.37
107 0.35
108 0.35
109 0.32
110 0.29
111 0.28
112 0.28
113 0.21
114 0.2
115 0.21
116 0.19
117 0.21
118 0.21
119 0.2
120 0.21
121 0.22
122 0.18
123 0.17
124 0.15
125 0.12
126 0.11
127 0.11
128 0.1
129 0.09
130 0.15
131 0.17
132 0.2
133 0.19
134 0.22
135 0.23
136 0.24
137 0.25
138 0.2
139 0.19
140 0.16
141 0.17
142 0.15
143 0.13
144 0.11
145 0.08
146 0.08
147 0.06
148 0.06
149 0.05
150 0.05
151 0.04
152 0.05
153 0.06
154 0.07
155 0.07
156 0.08
157 0.1
158 0.11
159 0.12
160 0.12
161 0.14
162 0.14
163 0.15
164 0.15
165 0.16
166 0.16
167 0.15
168 0.15
169 0.11
170 0.1
171 0.09
172 0.1
173 0.08
174 0.08
175 0.1
176 0.11
177 0.12
178 0.13
179 0.12
180 0.13
181 0.13
182 0.14
183 0.18
184 0.17
185 0.18
186 0.17
187 0.18
188 0.17
189 0.19
190 0.18
191 0.11
192 0.11
193 0.11
194 0.11
195 0.1
196 0.1
197 0.07
198 0.07
199 0.09
200 0.09
201 0.08
202 0.09
203 0.09
204 0.08
205 0.08
206 0.08
207 0.07
208 0.07
209 0.06
210 0.06
211 0.06
212 0.05
213 0.05
214 0.04
215 0.04
216 0.05
217 0.05
218 0.09
219 0.09
220 0.1
221 0.1
222 0.1
223 0.14
224 0.14
225 0.15
226 0.1
227 0.13
228 0.12
229 0.13
230 0.14
231 0.11
232 0.15
233 0.17
234 0.18
235 0.17
236 0.17
237 0.17
238 0.16
239 0.17
240 0.16
241 0.14
242 0.16
243 0.16
244 0.17
245 0.18
246 0.17
247 0.16
248 0.14
249 0.13
250 0.1
251 0.11
252 0.1
253 0.1
254 0.1
255 0.12
256 0.11
257 0.1
258 0.12
259 0.11
260 0.11
261 0.1
262 0.1
263 0.09
264 0.11
265 0.16
266 0.15
267 0.14
268 0.15
269 0.14
270 0.14
271 0.15
272 0.13
273 0.08
274 0.07
275 0.07
276 0.06
277 0.06
278 0.04
279 0.03
280 0.03
281 0.02
282 0.02
283 0.02
284 0.03
285 0.03
286 0.03
287 0.03
288 0.04
289 0.05
290 0.06
291 0.06
292 0.09
293 0.1
294 0.1
295 0.13
296 0.13
297 0.13
298 0.13
299 0.13
300 0.11
301 0.12
302 0.14
303 0.11
304 0.1
305 0.09
306 0.1
307 0.11
308 0.11
309 0.11
310 0.1
311 0.12
312 0.12
313 0.12
314 0.13
315 0.13
316 0.15
317 0.15
318 0.17
319 0.18
320 0.19
321 0.2
322 0.2
323 0.18
324 0.17
325 0.18
326 0.18
327 0.16
328 0.16
329 0.15
330 0.14
331 0.13
332 0.12
333 0.12
334 0.09
335 0.08
336 0.08
337 0.08
338 0.09
339 0.09
340 0.1
341 0.1
342 0.1
343 0.11
344 0.14
345 0.14
346 0.13
347 0.14
348 0.12
349 0.12
350 0.12
351 0.11
352 0.07
353 0.08
354 0.08
355 0.08
356 0.12
357 0.11
358 0.14
359 0.15
360 0.19
361 0.2
362 0.22
363 0.23
364 0.23
365 0.25
366 0.24
367 0.22
368 0.21
369 0.2
370 0.2
371 0.19
372 0.14
373 0.13
374 0.11
375 0.14
376 0.12
377 0.13
378 0.16
379 0.16
380 0.17
381 0.16
382 0.18
383 0.14
384 0.14
385 0.14
386 0.12
387 0.11
388 0.1
389 0.1
390 0.09
391 0.09
392 0.09
393 0.08
394 0.08
395 0.08
396 0.08