Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VD51

Protein Details
Accession A0A1L9VD51   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
91-123RTAIKAERAKKKKASKLKKTRRKYRDLESKEDEBasic
NLS Segment(s)
PositionSequence
95-114KAERAKKKKASKLKKTRRKY
Subcellular Location(s) nucl 18.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences RVFSLSAPTHDKPLPPRLKISDADLIIYYLKGTGPGGQKINKTNSAVQLIHKPTGIVVKSQATRSRSQNEKIAKQLLSDRVEDLEKGDQSRTAIKAERAKKKKASKLKKTRRKYRDLESKEDEDDEGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.51
4 0.51
5 0.54
6 0.51
7 0.51
8 0.47
9 0.39
10 0.37
11 0.31
12 0.26
13 0.21
14 0.2
15 0.14
16 0.08
17 0.07
18 0.06
19 0.06
20 0.11
21 0.14
22 0.18
23 0.22
24 0.25
25 0.29
26 0.33
27 0.38
28 0.37
29 0.36
30 0.35
31 0.35
32 0.37
33 0.34
34 0.3
35 0.33
36 0.32
37 0.3
38 0.27
39 0.23
40 0.18
41 0.22
42 0.21
43 0.14
44 0.13
45 0.16
46 0.18
47 0.2
48 0.25
49 0.23
50 0.26
51 0.3
52 0.35
53 0.35
54 0.36
55 0.4
56 0.41
57 0.41
58 0.41
59 0.41
60 0.35
61 0.31
62 0.33
63 0.33
64 0.3
65 0.27
66 0.24
67 0.21
68 0.22
69 0.2
70 0.18
71 0.15
72 0.14
73 0.14
74 0.14
75 0.14
76 0.15
77 0.19
78 0.18
79 0.18
80 0.2
81 0.24
82 0.33
83 0.41
84 0.5
85 0.53
86 0.59
87 0.65
88 0.72
89 0.76
90 0.79
91 0.81
92 0.82
93 0.87
94 0.91
95 0.92
96 0.93
97 0.95
98 0.93
99 0.92
100 0.88
101 0.88
102 0.88
103 0.84
104 0.82
105 0.78
106 0.73
107 0.65
108 0.59