Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VIP5

Protein Details
Accession A0A1L9VIP5   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MYTTKRDERKKKIYSSPFRLTTEHydrophilic
130-186TLRKRELAGRWWKRKGRREERKVEELTLSKRVWKKKKGREKRRIKEARQRKRIAAAYBasic
NLS Segment(s)
PositionSequence
132-182RKRELAGRWWKRKGRREERKVEELTLSKRVWKKKKGREKRRIKEARQRKRI
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MYTTKRDERKKKIYSSPFRLTTESCTPKTITGGLRIWVLSERKETTLFCRSSSRQKLNQGNLNRRGHESGKDGGGKDFRGGGSAFELTNVEGRGRGEMLDSSTGSVGQRKRSTIQSTEISTFACRTSLRTLRKRELAGRWWKRKGRREERKVEELTLSKRVWKKKKGREKRRIKEARQRKRIAAAYSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.85
4 0.81
5 0.75
6 0.69
7 0.6
8 0.56
9 0.56
10 0.53
11 0.45
12 0.42
13 0.4
14 0.38
15 0.38
16 0.36
17 0.28
18 0.27
19 0.28
20 0.26
21 0.26
22 0.25
23 0.24
24 0.24
25 0.23
26 0.19
27 0.22
28 0.22
29 0.23
30 0.25
31 0.25
32 0.26
33 0.33
34 0.32
35 0.29
36 0.34
37 0.35
38 0.44
39 0.53
40 0.54
41 0.52
42 0.61
43 0.67
44 0.68
45 0.72
46 0.7
47 0.7
48 0.72
49 0.69
50 0.61
51 0.55
52 0.52
53 0.46
54 0.41
55 0.35
56 0.28
57 0.27
58 0.28
59 0.26
60 0.24
61 0.24
62 0.21
63 0.17
64 0.17
65 0.13
66 0.12
67 0.11
68 0.1
69 0.09
70 0.1
71 0.09
72 0.08
73 0.08
74 0.07
75 0.08
76 0.08
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.06
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.11
93 0.12
94 0.18
95 0.2
96 0.21
97 0.24
98 0.3
99 0.34
100 0.32
101 0.35
102 0.33
103 0.34
104 0.33
105 0.31
106 0.26
107 0.22
108 0.2
109 0.15
110 0.13
111 0.1
112 0.11
113 0.19
114 0.26
115 0.35
116 0.42
117 0.5
118 0.55
119 0.6
120 0.61
121 0.6
122 0.59
123 0.59
124 0.62
125 0.66
126 0.68
127 0.71
128 0.75
129 0.78
130 0.8
131 0.82
132 0.83
133 0.84
134 0.85
135 0.86
136 0.87
137 0.86
138 0.79
139 0.7
140 0.64
141 0.58
142 0.52
143 0.48
144 0.4
145 0.39
146 0.43
147 0.51
148 0.55
149 0.6
150 0.67
151 0.71
152 0.82
153 0.86
154 0.91
155 0.92
156 0.94
157 0.94
158 0.95
159 0.95
160 0.93
161 0.93
162 0.93
163 0.93
164 0.93
165 0.88
166 0.83
167 0.81
168 0.78