Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NDY7

Protein Details
Accession C0NDY7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
157-185LEILSQNRRRDNPKKRRRPIKTIIIRGGYHydrophilic
NLS Segment(s)
PositionSequence
164-177RRRDNPKKRRRPIK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, cyto 2.5, mito 2
Family & Domain DBs
Amino Acid Sequences MIFFQQNYIAHATSWYDSKTLDDSTLLTRIVGKRINLIDMDREHFKLELAYLSPATARPDSARRNLKSCASTGEMKHALLRRRARQSCLFEDAQARRLAEFQAGPFLVGATRLLRDFSSSIRHRPHNPRSRDRTLQILAAPIMCQKVSRFRSHGLNLEILSQNRRRDNPKKRRRPIKTIIIRGGYSGWTKDLDYPRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.15
4 0.14
5 0.17
6 0.18
7 0.17
8 0.17
9 0.15
10 0.16
11 0.18
12 0.2
13 0.18
14 0.15
15 0.18
16 0.19
17 0.24
18 0.26
19 0.24
20 0.27
21 0.28
22 0.3
23 0.27
24 0.26
25 0.26
26 0.25
27 0.29
28 0.25
29 0.25
30 0.24
31 0.22
32 0.21
33 0.16
34 0.14
35 0.12
36 0.11
37 0.12
38 0.1
39 0.11
40 0.11
41 0.11
42 0.14
43 0.12
44 0.12
45 0.13
46 0.21
47 0.25
48 0.33
49 0.42
50 0.41
51 0.44
52 0.46
53 0.49
54 0.43
55 0.39
56 0.35
57 0.29
58 0.3
59 0.27
60 0.31
61 0.27
62 0.25
63 0.28
64 0.29
65 0.29
66 0.33
67 0.39
68 0.4
69 0.49
70 0.51
71 0.53
72 0.56
73 0.58
74 0.54
75 0.53
76 0.46
77 0.37
78 0.4
79 0.36
80 0.32
81 0.27
82 0.23
83 0.18
84 0.18
85 0.17
86 0.12
87 0.12
88 0.08
89 0.1
90 0.09
91 0.09
92 0.08
93 0.08
94 0.06
95 0.06
96 0.07
97 0.05
98 0.05
99 0.05
100 0.06
101 0.06
102 0.08
103 0.09
104 0.1
105 0.18
106 0.19
107 0.26
108 0.3
109 0.35
110 0.41
111 0.51
112 0.6
113 0.61
114 0.68
115 0.72
116 0.75
117 0.79
118 0.77
119 0.69
120 0.65
121 0.57
122 0.51
123 0.42
124 0.35
125 0.27
126 0.21
127 0.19
128 0.13
129 0.13
130 0.1
131 0.1
132 0.1
133 0.19
134 0.23
135 0.29
136 0.31
137 0.34
138 0.42
139 0.46
140 0.5
141 0.43
142 0.42
143 0.36
144 0.37
145 0.36
146 0.3
147 0.32
148 0.31
149 0.34
150 0.37
151 0.42
152 0.47
153 0.55
154 0.65
155 0.7
156 0.76
157 0.82
158 0.87
159 0.93
160 0.93
161 0.92
162 0.91
163 0.91
164 0.9
165 0.88
166 0.85
167 0.79
168 0.7
169 0.61
170 0.52
171 0.44
172 0.36
173 0.27
174 0.21
175 0.18
176 0.19
177 0.25