Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VFS0

Protein Details
Accession A0A1L9VFS0   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-40VESRVRRECGWKRPTQKGRKRLCWTTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKGVCIRSTEYRVVESRVRRECGWKRPTQKGRKRLCWTTPVLCIILDLFYKLPSVASLFIYFCSSQRGASICFLSYNPTLPSLSPSLSTIVPWPSFVCYLDLYNTDSYNAVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.46
4 0.47
5 0.49
6 0.46
7 0.54
8 0.58
9 0.62
10 0.64
11 0.63
12 0.64
13 0.71
14 0.8
15 0.81
16 0.83
17 0.83
18 0.84
19 0.86
20 0.86
21 0.83
22 0.78
23 0.74
24 0.7
25 0.63
26 0.56
27 0.48
28 0.4
29 0.32
30 0.26
31 0.19
32 0.15
33 0.11
34 0.08
35 0.07
36 0.06
37 0.07
38 0.06
39 0.06
40 0.05
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.1
49 0.09
50 0.12
51 0.12
52 0.11
53 0.12
54 0.13
55 0.13
56 0.15
57 0.16
58 0.12
59 0.13
60 0.13
61 0.15
62 0.14
63 0.15
64 0.13
65 0.14
66 0.14
67 0.14
68 0.17
69 0.15
70 0.15
71 0.14
72 0.14
73 0.15
74 0.14
75 0.15
76 0.14
77 0.17
78 0.16
79 0.17
80 0.16
81 0.17
82 0.18
83 0.18
84 0.18
85 0.15
86 0.16
87 0.18
88 0.19
89 0.19
90 0.2
91 0.2
92 0.18