Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VD84

Protein Details
Accession A0A1L9VD84   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-81DNTNAISSQKKKKKKLHIVPSARANGHydrophilic
NLS Segment(s)
PositionSequence
65-70KKKKKK
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
Amino Acid Sequences MTRIASAIGIGLLLQRCQTNLHEDRTDMDGAIALCQWLSNKIEYNIRAASQILQLDNTNAISSQKKKKKKLHIVPSARANGQISSHLRMLSIKNQSHPAVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.13
5 0.15
6 0.21
7 0.24
8 0.3
9 0.3
10 0.3
11 0.32
12 0.33
13 0.31
14 0.22
15 0.17
16 0.14
17 0.12
18 0.12
19 0.1
20 0.06
21 0.06
22 0.06
23 0.06
24 0.07
25 0.08
26 0.09
27 0.11
28 0.13
29 0.17
30 0.18
31 0.21
32 0.19
33 0.18
34 0.17
35 0.16
36 0.15
37 0.12
38 0.13
39 0.1
40 0.1
41 0.09
42 0.09
43 0.09
44 0.09
45 0.07
46 0.06
47 0.08
48 0.11
49 0.16
50 0.26
51 0.35
52 0.44
53 0.54
54 0.63
55 0.72
56 0.8
57 0.85
58 0.86
59 0.88
60 0.88
61 0.85
62 0.83
63 0.76
64 0.65
65 0.57
66 0.47
67 0.38
68 0.3
69 0.3
70 0.25
71 0.24
72 0.26
73 0.24
74 0.23
75 0.24
76 0.27
77 0.28
78 0.35
79 0.34
80 0.36
81 0.42