Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VLX0

Protein Details
Accession A0A1L9VLX0    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
495-527GFGPHTNKKPYVRSKGRKFERARGRRRSKGFKVBasic
NLS Segment(s)
PositionSequence
500-527TNKKPYVRSKGRKFERARGRRRSKGFKV
Subcellular Location(s) cyto 15, cyto_nucl 10.5, mito 7, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR002067  Mit_carrier  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
IPR021132  Ribosomal_L18/L18-A/B/e_CS  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
GO:0055085  P:transmembrane transport  
Pfam View protein in Pfam  
PF00153  Mito_carr  
PF17135  Ribosomal_L18  
PROSITE View protein in PROSITE  
PS01106  RIBOSOMAL_L18E  
PS50920  SOLCAR  
Amino Acid Sequences MSLNRQQTNREGGVEGSKREPLSQLQSSSTSASESIRSEKTPSFKKVRSKIGEPVVAAFIAGGVAGAVSRTIVSPLERLKILLQIQSVGREEYKLSIWKALVKMWREEGWRGFMRGNGTNCIRIVPYSAVQFGSYNLYKKYAENSPGADLSPIRRLLCGGAAGITSVIITYPLDIVRTRLSIQSASFAALEKRGADERLPGMFRTMALMYKKEGGILALYRGIVPTVAGVAPYVGLNFMTYESARKYLTPEGDINPSSIRKLLAGAISGAVAQTCTYPFDVLRRRFQINTMSGMGYQYKSIWDAVRVIVAEEGMHGLFKGIGPNLLKVAPSMASSWLSFEPPIIGIDLDRHHVRSTHRKAPKSENVYLQVLVKLYRFLARRTDSNFNKVVLRRLFMSRINRPPVSLSRIVSNITESHKGKTVVIIGSVTDDNRLLTVPKLSIAALRFTATARARIEKAGGETLTLDQLALRAPTGANTLLLRGPKNSREAVKHFGFGPHTNKKPYVRSKGRKFERARGRRRSKGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.32
4 0.35
5 0.33
6 0.33
7 0.34
8 0.3
9 0.35
10 0.37
11 0.37
12 0.36
13 0.38
14 0.38
15 0.37
16 0.31
17 0.24
18 0.2
19 0.19
20 0.19
21 0.19
22 0.22
23 0.24
24 0.25
25 0.28
26 0.32
27 0.39
28 0.44
29 0.5
30 0.54
31 0.58
32 0.67
33 0.71
34 0.77
35 0.76
36 0.73
37 0.73
38 0.72
39 0.7
40 0.6
41 0.54
42 0.45
43 0.37
44 0.31
45 0.22
46 0.13
47 0.08
48 0.07
49 0.04
50 0.02
51 0.02
52 0.02
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.05
59 0.07
60 0.08
61 0.13
62 0.17
63 0.2
64 0.2
65 0.21
66 0.21
67 0.26
68 0.27
69 0.25
70 0.23
71 0.23
72 0.23
73 0.26
74 0.26
75 0.22
76 0.2
77 0.18
78 0.18
79 0.17
80 0.19
81 0.2
82 0.2
83 0.22
84 0.23
85 0.27
86 0.28
87 0.31
88 0.33
89 0.31
90 0.34
91 0.34
92 0.37
93 0.35
94 0.38
95 0.36
96 0.37
97 0.36
98 0.35
99 0.32
100 0.3
101 0.31
102 0.33
103 0.33
104 0.31
105 0.31
106 0.32
107 0.31
108 0.3
109 0.25
110 0.19
111 0.2
112 0.17
113 0.17
114 0.17
115 0.18
116 0.17
117 0.17
118 0.17
119 0.15
120 0.18
121 0.18
122 0.18
123 0.18
124 0.21
125 0.21
126 0.22
127 0.25
128 0.25
129 0.27
130 0.28
131 0.29
132 0.29
133 0.28
134 0.27
135 0.24
136 0.19
137 0.17
138 0.2
139 0.2
140 0.18
141 0.17
142 0.17
143 0.17
144 0.18
145 0.16
146 0.11
147 0.09
148 0.08
149 0.08
150 0.07
151 0.06
152 0.05
153 0.04
154 0.03
155 0.03
156 0.03
157 0.04
158 0.05
159 0.05
160 0.07
161 0.07
162 0.09
163 0.1
164 0.12
165 0.12
166 0.13
167 0.14
168 0.15
169 0.15
170 0.16
171 0.14
172 0.14
173 0.13
174 0.12
175 0.11
176 0.11
177 0.11
178 0.08
179 0.1
180 0.11
181 0.11
182 0.11
183 0.13
184 0.14
185 0.17
186 0.18
187 0.16
188 0.16
189 0.15
190 0.15
191 0.14
192 0.13
193 0.13
194 0.13
195 0.14
196 0.14
197 0.16
198 0.16
199 0.14
200 0.13
201 0.1
202 0.1
203 0.09
204 0.09
205 0.08
206 0.08
207 0.07
208 0.07
209 0.07
210 0.05
211 0.05
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.03
222 0.03
223 0.03
224 0.04
225 0.04
226 0.05
227 0.05
228 0.07
229 0.08
230 0.09
231 0.1
232 0.1
233 0.12
234 0.15
235 0.17
236 0.18
237 0.19
238 0.19
239 0.22
240 0.22
241 0.2
242 0.18
243 0.17
244 0.14
245 0.13
246 0.11
247 0.08
248 0.09
249 0.09
250 0.08
251 0.08
252 0.08
253 0.07
254 0.07
255 0.07
256 0.06
257 0.04
258 0.03
259 0.03
260 0.03
261 0.04
262 0.04
263 0.05
264 0.06
265 0.06
266 0.13
267 0.21
268 0.25
269 0.31
270 0.34
271 0.36
272 0.36
273 0.38
274 0.38
275 0.32
276 0.32
277 0.27
278 0.24
279 0.21
280 0.22
281 0.2
282 0.13
283 0.12
284 0.09
285 0.07
286 0.08
287 0.09
288 0.09
289 0.09
290 0.1
291 0.1
292 0.11
293 0.1
294 0.1
295 0.08
296 0.08
297 0.06
298 0.05
299 0.06
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.04
306 0.06
307 0.05
308 0.08
309 0.09
310 0.1
311 0.11
312 0.11
313 0.11
314 0.09
315 0.1
316 0.08
317 0.08
318 0.09
319 0.09
320 0.1
321 0.1
322 0.12
323 0.12
324 0.12
325 0.11
326 0.1
327 0.09
328 0.09
329 0.09
330 0.07
331 0.06
332 0.06
333 0.09
334 0.09
335 0.12
336 0.12
337 0.13
338 0.13
339 0.17
340 0.22
341 0.31
342 0.38
343 0.44
344 0.51
345 0.56
346 0.61
347 0.67
348 0.71
349 0.68
350 0.66
351 0.62
352 0.58
353 0.55
354 0.5
355 0.41
356 0.33
357 0.26
358 0.22
359 0.16
360 0.12
361 0.11
362 0.16
363 0.16
364 0.17
365 0.25
366 0.27
367 0.31
368 0.36
369 0.45
370 0.44
371 0.48
372 0.48
373 0.41
374 0.45
375 0.42
376 0.44
377 0.36
378 0.35
379 0.32
380 0.33
381 0.35
382 0.35
383 0.42
384 0.42
385 0.49
386 0.54
387 0.51
388 0.49
389 0.5
390 0.49
391 0.48
392 0.44
393 0.36
394 0.32
395 0.34
396 0.34
397 0.29
398 0.26
399 0.22
400 0.21
401 0.28
402 0.26
403 0.26
404 0.3
405 0.31
406 0.29
407 0.29
408 0.29
409 0.23
410 0.23
411 0.21
412 0.16
413 0.17
414 0.18
415 0.15
416 0.12
417 0.11
418 0.1
419 0.1
420 0.11
421 0.09
422 0.09
423 0.12
424 0.11
425 0.12
426 0.13
427 0.13
428 0.16
429 0.16
430 0.18
431 0.16
432 0.16
433 0.16
434 0.16
435 0.23
436 0.21
437 0.26
438 0.26
439 0.29
440 0.3
441 0.31
442 0.32
443 0.27
444 0.29
445 0.28
446 0.25
447 0.21
448 0.21
449 0.2
450 0.19
451 0.17
452 0.13
453 0.08
454 0.09
455 0.1
456 0.09
457 0.08
458 0.08
459 0.08
460 0.09
461 0.12
462 0.12
463 0.13
464 0.13
465 0.14
466 0.16
467 0.2
468 0.2
469 0.22
470 0.28
471 0.31
472 0.36
473 0.4
474 0.43
475 0.48
476 0.52
477 0.56
478 0.53
479 0.5
480 0.46
481 0.46
482 0.44
483 0.43
484 0.46
485 0.48
486 0.51
487 0.55
488 0.6
489 0.62
490 0.67
491 0.71
492 0.73
493 0.74
494 0.79
495 0.84
496 0.89
497 0.91
498 0.91
499 0.88
500 0.87
501 0.87
502 0.87
503 0.87
504 0.87
505 0.88
506 0.88
507 0.91