Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9V3X4

Protein Details
Accession A0A1L9V3X4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
120-155PLVPGPRRKPQLRPGPRPRKGTRRRLGLHRHVRSRABasic
NLS Segment(s)
PositionSequence
113-154KRRLNPSPLVPGPRRKPQLRPGPRPRKGTRRRLGLHRHVRSR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MPFQRSVNYSYPDAVATAKLRESCREGDLARVQELLLRSNQSDGSWTLALRDAATKNHIDIMRFLLDSKCDNRLECGGRSTISRSIYTRVRAWIGYPSKPELAPCFLDACRSKRRLNPSPLVPGPRRKPQLRPGPRPRKGTRRRLGLHRHVRSRAGASSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.16
4 0.16
5 0.18
6 0.21
7 0.23
8 0.26
9 0.29
10 0.29
11 0.29
12 0.31
13 0.28
14 0.31
15 0.35
16 0.34
17 0.3
18 0.27
19 0.25
20 0.24
21 0.24
22 0.19
23 0.15
24 0.15
25 0.14
26 0.16
27 0.16
28 0.13
29 0.15
30 0.13
31 0.15
32 0.14
33 0.14
34 0.13
35 0.15
36 0.15
37 0.13
38 0.16
39 0.13
40 0.14
41 0.17
42 0.16
43 0.14
44 0.19
45 0.2
46 0.17
47 0.17
48 0.19
49 0.18
50 0.17
51 0.18
52 0.13
53 0.14
54 0.15
55 0.16
56 0.17
57 0.16
58 0.16
59 0.17
60 0.21
61 0.23
62 0.21
63 0.21
64 0.17
65 0.17
66 0.17
67 0.18
68 0.17
69 0.16
70 0.17
71 0.16
72 0.19
73 0.22
74 0.25
75 0.24
76 0.22
77 0.21
78 0.2
79 0.2
80 0.24
81 0.25
82 0.24
83 0.25
84 0.26
85 0.26
86 0.26
87 0.26
88 0.2
89 0.2
90 0.19
91 0.18
92 0.18
93 0.17
94 0.22
95 0.25
96 0.27
97 0.32
98 0.36
99 0.39
100 0.43
101 0.52
102 0.56
103 0.61
104 0.63
105 0.61
106 0.65
107 0.65
108 0.66
109 0.62
110 0.62
111 0.6
112 0.62
113 0.64
114 0.6
115 0.64
116 0.67
117 0.73
118 0.74
119 0.79
120 0.81
121 0.84
122 0.87
123 0.89
124 0.87
125 0.87
126 0.87
127 0.87
128 0.85
129 0.84
130 0.83
131 0.84
132 0.86
133 0.86
134 0.86
135 0.85
136 0.84
137 0.78
138 0.75
139 0.69
140 0.63