Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VG91

Protein Details
Accession A0A1L9VG91    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
67-93ASTSTPSRPKRSQRRFKPRRCPCYFHAHydrophilic
NLS Segment(s)
PositionSequence
75-84PKRSQRRFKP
Subcellular Location(s) plas 21, mito 3, nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLGASNMSFIHDQNERDFEWGDKSPVIPSPPSYSLSTYSPPSYSSLPPILEAAETPALTPSQPAQASTSTPSRPKRSQRRFKPRRCPCYFHAESCVKLFWLTVVIIVIVGFIVGFILGLVDYFAPGTLAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.23
4 0.25
5 0.25
6 0.22
7 0.23
8 0.23
9 0.22
10 0.19
11 0.19
12 0.19
13 0.21
14 0.23
15 0.19
16 0.19
17 0.23
18 0.25
19 0.27
20 0.27
21 0.26
22 0.26
23 0.28
24 0.28
25 0.24
26 0.23
27 0.2
28 0.2
29 0.2
30 0.2
31 0.18
32 0.2
33 0.2
34 0.19
35 0.19
36 0.18
37 0.16
38 0.13
39 0.12
40 0.1
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.06
49 0.09
50 0.1
51 0.1
52 0.11
53 0.12
54 0.13
55 0.15
56 0.18
57 0.16
58 0.22
59 0.27
60 0.32
61 0.39
62 0.48
63 0.57
64 0.65
65 0.74
66 0.79
67 0.85
68 0.89
69 0.92
70 0.94
71 0.93
72 0.93
73 0.89
74 0.84
75 0.76
76 0.76
77 0.69
78 0.61
79 0.58
80 0.5
81 0.44
82 0.4
83 0.37
84 0.26
85 0.23
86 0.19
87 0.12
88 0.11
89 0.09
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.04
97 0.03
98 0.03
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.04