Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9VGT1

Protein Details
Accession A0A1L9VGT1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-73LPKPVVKHTQSRNKKRRAPKTVFMRQEHydrophilic
NLS Segment(s)
PositionSequence
58-64RNKKRRA
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MGSYIGDAYWRSRISTDLFHEVRDVMDETLDWEFLCLKLDDLTDALLPKPVVKHTQSRNKKRRAPKTVFMRQEIPEGLEWLACRRYILRRLNKVQEIVSKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.3
4 0.33
5 0.33
6 0.32
7 0.32
8 0.3
9 0.26
10 0.22
11 0.19
12 0.1
13 0.1
14 0.09
15 0.1
16 0.1
17 0.1
18 0.07
19 0.06
20 0.07
21 0.07
22 0.09
23 0.07
24 0.07
25 0.08
26 0.08
27 0.08
28 0.08
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.13
39 0.15
40 0.22
41 0.29
42 0.4
43 0.5
44 0.6
45 0.68
46 0.74
47 0.8
48 0.84
49 0.86
50 0.86
51 0.83
52 0.81
53 0.82
54 0.82
55 0.79
56 0.72
57 0.66
58 0.57
59 0.53
60 0.44
61 0.35
62 0.26
63 0.22
64 0.19
65 0.15
66 0.14
67 0.14
68 0.14
69 0.13
70 0.13
71 0.15
72 0.22
73 0.3
74 0.4
75 0.48
76 0.56
77 0.65
78 0.73
79 0.75
80 0.71
81 0.67