Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C0NRK7

Protein Details
Accession C0NRK7   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
36-62WLTSPSPRPKSRRRRRVRAADRARARGBasic
NLS Segment(s)
PositionSequence
40-61PSPRPKSRRRRRVRAADRARAR
Subcellular Location(s) cyto 12, nucl 8, cyto_mito 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVEEMVDGMVDGMVDGGGGRRVGVGRRESGGGHAAWLTSPSPRPKSRRRRRVRAADRARARGMGMGMFAGCAAAAAAAAGGGPPTHPPARVDIDRESDRQTDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.05
5 0.05
6 0.05
7 0.06
8 0.08
9 0.11
10 0.16
11 0.19
12 0.2
13 0.21
14 0.22
15 0.22
16 0.22
17 0.22
18 0.16
19 0.14
20 0.12
21 0.1
22 0.09
23 0.1
24 0.08
25 0.08
26 0.12
27 0.17
28 0.24
29 0.3
30 0.37
31 0.47
32 0.58
33 0.67
34 0.74
35 0.79
36 0.83
37 0.87
38 0.91
39 0.9
40 0.9
41 0.88
42 0.86
43 0.81
44 0.75
45 0.65
46 0.54
47 0.45
48 0.35
49 0.26
50 0.17
51 0.12
52 0.08
53 0.07
54 0.06
55 0.06
56 0.04
57 0.03
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.03
70 0.04
71 0.1
72 0.11
73 0.13
74 0.14
75 0.2
76 0.27
77 0.3
78 0.33
79 0.33
80 0.4
81 0.42
82 0.43
83 0.42