Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9VMR2

Protein Details
Accession A0A1L9VMR2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-45QEKKKQPKGRAMKRLKYTRRFVBasic
NLS Segment(s)
PositionSequence
12-41GKVKSATPKVEAQEKKKQPKGRAMKRLKYT
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSATPKVEAQEKKKQPKGRAMKRLKYTRRFVNVTMTGGKRKMNPNPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.38
4 0.35
5 0.36
6 0.4
7 0.39
8 0.46
9 0.48
10 0.46
11 0.5
12 0.56
13 0.62
14 0.65
15 0.68
16 0.64
17 0.69
18 0.73
19 0.72
20 0.74
21 0.75
22 0.76
23 0.79
24 0.84
25 0.83
26 0.81
27 0.78
28 0.76
29 0.74
30 0.7
31 0.62
32 0.61
33 0.55
34 0.49
35 0.49
36 0.43
37 0.4
38 0.38
39 0.4
40 0.37
41 0.42
42 0.47