Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VAZ9

Protein Details
Accession A0A1L9VAZ9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-23AAPRKRTKISHDPNNVNWSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01585  G-patch  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MGLAAPRKRTKISHDPNNVNWSRSTSGFGHKILSSQGWTPGSLLGARNAAHADMLTPASASHIRVTVKDDTLGLGARPKTLNEPTGLDAFKGLLGRLNGKSDVELEKEQRKRDDIKLAQYAATKWQAVRFVRGGLLVQEKTDAATTKFPENKSTDEKGNGTNNDVTIDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.74
4 0.8
5 0.73
6 0.63
7 0.54
8 0.48
9 0.41
10 0.35
11 0.33
12 0.26
13 0.31
14 0.33
15 0.33
16 0.31
17 0.28
18 0.28
19 0.25
20 0.24
21 0.19
22 0.16
23 0.21
24 0.19
25 0.19
26 0.18
27 0.17
28 0.16
29 0.16
30 0.15
31 0.11
32 0.13
33 0.12
34 0.13
35 0.12
36 0.11
37 0.1
38 0.09
39 0.08
40 0.07
41 0.07
42 0.06
43 0.06
44 0.05
45 0.08
46 0.09
47 0.09
48 0.09
49 0.11
50 0.12
51 0.13
52 0.17
53 0.17
54 0.17
55 0.17
56 0.16
57 0.13
58 0.13
59 0.13
60 0.09
61 0.1
62 0.1
63 0.11
64 0.11
65 0.11
66 0.14
67 0.16
68 0.17
69 0.15
70 0.16
71 0.16
72 0.18
73 0.18
74 0.14
75 0.12
76 0.11
77 0.1
78 0.09
79 0.07
80 0.07
81 0.07
82 0.11
83 0.12
84 0.14
85 0.13
86 0.13
87 0.13
88 0.13
89 0.14
90 0.15
91 0.16
92 0.18
93 0.26
94 0.3
95 0.33
96 0.34
97 0.36
98 0.37
99 0.4
100 0.47
101 0.42
102 0.46
103 0.48
104 0.46
105 0.44
106 0.41
107 0.37
108 0.31
109 0.29
110 0.23
111 0.18
112 0.21
113 0.25
114 0.25
115 0.29
116 0.26
117 0.24
118 0.24
119 0.24
120 0.21
121 0.18
122 0.23
123 0.18
124 0.17
125 0.17
126 0.16
127 0.16
128 0.17
129 0.16
130 0.12
131 0.18
132 0.2
133 0.28
134 0.33
135 0.33
136 0.38
137 0.4
138 0.44
139 0.46
140 0.48
141 0.45
142 0.45
143 0.47
144 0.46
145 0.51
146 0.46
147 0.43
148 0.41
149 0.36