Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9V7E3

Protein Details
Accession A0A1L9V7E3    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
269-300RDFDRRPFRDNRSPPRRRSPGRFREPPPRREFBasic
302-333SYVPSGPRRGHHDRKRRRSLQRYTPAARRRRNBasic
NLS Segment(s)
PositionSequence
251-332RERFDRGRGRGRGGGRGGRDFDRRPFRDNRSPPRRRSPGRFREPPPRREFDSYVPSGPRRGHHDRKRRRSLQRYTPAARRRR
396-400RAMRR
Subcellular Location(s) nucl 21.5, cyto_nucl 14.333, mito_nucl 11.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR002483  PWI_dom  
IPR036483  PWI_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF01480  PWI  
PROSITE View protein in PROSITE  
PS51025  PWI  
Amino Acid Sequences MQVAEILSDITSLRVCDHTDALTLVTVNERLPARAPSQETQSQTQSQSQAQSHRDSNEDLRRAKELVDLHHELKTRHANGTVDEELARARESVRKVLKELTKMASVDVKMLRQTKFPPEFSRKVDMTKVNIEVMKKWIAGKISEILGNEDDVVIELCFNLLEGSRYPDVKSLQIQLTGFLDKDTGKFCKELWSLCLSAQENPQGVPKELLEAKKLELIQEKIEAEKAAEESQRQKEQERTRERELQDLRQRERFDRGRGRGRGGGRGGRDFDRRPFRDNRSPPRRRSPGRFREPPPRREFDSYVPSGPRRGHHDRKRRRSLQRYTPAARRRRNSSSVSVPTEKRQRLTDEDEGPPPPPPADRSSSANKEMKDADEPKGTRISSTELREKLLRERIRAMRRRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.16
4 0.18
5 0.18
6 0.18
7 0.19
8 0.17
9 0.16
10 0.15
11 0.13
12 0.13
13 0.13
14 0.11
15 0.16
16 0.16
17 0.16
18 0.18
19 0.22
20 0.22
21 0.28
22 0.33
23 0.31
24 0.38
25 0.43
26 0.44
27 0.45
28 0.47
29 0.46
30 0.43
31 0.45
32 0.42
33 0.39
34 0.41
35 0.41
36 0.43
37 0.43
38 0.46
39 0.44
40 0.43
41 0.42
42 0.4
43 0.44
44 0.46
45 0.49
46 0.46
47 0.44
48 0.45
49 0.43
50 0.4
51 0.36
52 0.3
53 0.28
54 0.33
55 0.35
56 0.34
57 0.37
58 0.39
59 0.34
60 0.38
61 0.42
62 0.36
63 0.34
64 0.36
65 0.33
66 0.33
67 0.4
68 0.33
69 0.26
70 0.23
71 0.21
72 0.17
73 0.17
74 0.16
75 0.09
76 0.09
77 0.14
78 0.17
79 0.25
80 0.32
81 0.33
82 0.35
83 0.42
84 0.46
85 0.45
86 0.47
87 0.42
88 0.38
89 0.36
90 0.35
91 0.32
92 0.27
93 0.27
94 0.24
95 0.22
96 0.23
97 0.28
98 0.27
99 0.26
100 0.3
101 0.35
102 0.4
103 0.42
104 0.46
105 0.5
106 0.55
107 0.56
108 0.59
109 0.51
110 0.48
111 0.5
112 0.45
113 0.41
114 0.39
115 0.36
116 0.32
117 0.33
118 0.3
119 0.26
120 0.25
121 0.23
122 0.2
123 0.19
124 0.18
125 0.18
126 0.17
127 0.18
128 0.17
129 0.15
130 0.16
131 0.16
132 0.15
133 0.14
134 0.14
135 0.12
136 0.09
137 0.08
138 0.06
139 0.06
140 0.04
141 0.04
142 0.04
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.05
149 0.05
150 0.09
151 0.11
152 0.12
153 0.12
154 0.16
155 0.17
156 0.18
157 0.19
158 0.19
159 0.19
160 0.2
161 0.2
162 0.17
163 0.18
164 0.16
165 0.14
166 0.1
167 0.1
168 0.08
169 0.09
170 0.11
171 0.11
172 0.11
173 0.12
174 0.12
175 0.19
176 0.2
177 0.2
178 0.2
179 0.22
180 0.22
181 0.21
182 0.26
183 0.18
184 0.19
185 0.2
186 0.2
187 0.17
188 0.16
189 0.19
190 0.16
191 0.16
192 0.15
193 0.13
194 0.14
195 0.16
196 0.17
197 0.15
198 0.15
199 0.15
200 0.17
201 0.17
202 0.16
203 0.17
204 0.17
205 0.17
206 0.19
207 0.18
208 0.16
209 0.16
210 0.14
211 0.11
212 0.1
213 0.1
214 0.1
215 0.1
216 0.12
217 0.17
218 0.22
219 0.27
220 0.27
221 0.29
222 0.35
223 0.42
224 0.51
225 0.55
226 0.56
227 0.58
228 0.65
229 0.63
230 0.63
231 0.59
232 0.58
233 0.56
234 0.57
235 0.55
236 0.52
237 0.54
238 0.47
239 0.52
240 0.48
241 0.49
242 0.51
243 0.55
244 0.59
245 0.59
246 0.61
247 0.58
248 0.55
249 0.52
250 0.47
251 0.44
252 0.37
253 0.37
254 0.36
255 0.34
256 0.37
257 0.33
258 0.37
259 0.43
260 0.43
261 0.45
262 0.5
263 0.55
264 0.61
265 0.68
266 0.71
267 0.72
268 0.79
269 0.8
270 0.83
271 0.85
272 0.82
273 0.83
274 0.83
275 0.82
276 0.84
277 0.85
278 0.8
279 0.81
280 0.82
281 0.82
282 0.78
283 0.73
284 0.68
285 0.66
286 0.65
287 0.6
288 0.6
289 0.53
290 0.49
291 0.47
292 0.43
293 0.4
294 0.39
295 0.35
296 0.36
297 0.43
298 0.5
299 0.56
300 0.66
301 0.73
302 0.82
303 0.89
304 0.91
305 0.92
306 0.92
307 0.92
308 0.92
309 0.91
310 0.89
311 0.84
312 0.84
313 0.82
314 0.81
315 0.8
316 0.75
317 0.73
318 0.72
319 0.72
320 0.69
321 0.67
322 0.66
323 0.65
324 0.66
325 0.64
326 0.58
327 0.6
328 0.64
329 0.6
330 0.54
331 0.51
332 0.49
333 0.5
334 0.55
335 0.55
336 0.51
337 0.51
338 0.51
339 0.48
340 0.44
341 0.39
342 0.32
343 0.25
344 0.22
345 0.22
346 0.24
347 0.29
348 0.31
349 0.35
350 0.43
351 0.48
352 0.54
353 0.55
354 0.5
355 0.48
356 0.48
357 0.45
358 0.44
359 0.42
360 0.38
361 0.43
362 0.43
363 0.42
364 0.46
365 0.43
366 0.35
367 0.33
368 0.35
369 0.33
370 0.4
371 0.45
372 0.4
373 0.45
374 0.47
375 0.48
376 0.5
377 0.52
378 0.51
379 0.47
380 0.55
381 0.61
382 0.68