Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9VV28

Protein Details
Accession A0A1L9VV28    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
109-132LLNWLLEKKRWWRCKTKKIDCGRGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, cyto 3, pero 2, vacu 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002350  Kazal_dom  
IPR036058  Kazal_dom_sf  
Pfam View protein in Pfam  
PF07648  Kazal_2  
Amino Acid Sequences MQLILATLLLPLSQAFPAPVPVPVPVIEEGIALANVCSETCPEALSPICAKNAAGAFEIFDNPCMFNKANCKGLDYVQVDLSGCRGLITDSDGVPIEANGKFHDYWVLLLNWLLEKKRWWRCKTKKIDCGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.08
4 0.11
5 0.11
6 0.12
7 0.11
8 0.12
9 0.13
10 0.13
11 0.15
12 0.13
13 0.13
14 0.12
15 0.11
16 0.11
17 0.1
18 0.09
19 0.06
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.06
27 0.06
28 0.07
29 0.07
30 0.09
31 0.09
32 0.11
33 0.13
34 0.13
35 0.13
36 0.13
37 0.12
38 0.13
39 0.14
40 0.13
41 0.12
42 0.1
43 0.1
44 0.1
45 0.12
46 0.09
47 0.08
48 0.08
49 0.07
50 0.08
51 0.1
52 0.1
53 0.11
54 0.17
55 0.19
56 0.24
57 0.24
58 0.26
59 0.24
60 0.25
61 0.31
62 0.26
63 0.24
64 0.19
65 0.19
66 0.17
67 0.16
68 0.16
69 0.08
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.08
76 0.09
77 0.08
78 0.1
79 0.1
80 0.1
81 0.1
82 0.09
83 0.09
84 0.09
85 0.1
86 0.09
87 0.13
88 0.12
89 0.13
90 0.15
91 0.13
92 0.14
93 0.16
94 0.16
95 0.13
96 0.13
97 0.14
98 0.14
99 0.16
100 0.16
101 0.15
102 0.2
103 0.3
104 0.4
105 0.49
106 0.54
107 0.63
108 0.73
109 0.82
110 0.88
111 0.89
112 0.88