Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9V8A4

Protein Details
Accession A0A1L9V8A4    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
118-139STAFSRKKHRTITRSHSRQPSIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, mito 7, cyto_nucl 4, nucl 3.5, cyto 3.5, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044993  BXL  
IPR002772  Glyco_hydro_3_C  
IPR036881  Glyco_hydro_3_C_sf  
Gene Ontology GO:0009044  F:xylan 1,4-beta-xylosidase activity  
GO:0045493  P:xylan catabolic process  
Pfam View protein in Pfam  
PF01915  Glyco_hydro_3_C  
Amino Acid Sequences CTVALIERLCALGKPCVVIQVGDLLDDTPLLQSSNFSAILWAAYPGQDGGPAIFDVLTGLVPPAGRLPVTKYPARYVDQIPMTYMTLRPRGNQPGRTYWFDQNAVLPFGYGLHYSNFSTAFSRKKHRTITRSHSRQPSIYTGSRTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.19
5 0.18
6 0.16
7 0.17
8 0.16
9 0.14
10 0.14
11 0.11
12 0.11
13 0.1
14 0.1
15 0.05
16 0.05
17 0.06
18 0.05
19 0.06
20 0.07
21 0.1
22 0.1
23 0.1
24 0.09
25 0.09
26 0.1
27 0.09
28 0.08
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.04
43 0.05
44 0.04
45 0.03
46 0.03
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.11
55 0.16
56 0.2
57 0.22
58 0.23
59 0.25
60 0.28
61 0.3
62 0.28
63 0.24
64 0.25
65 0.25
66 0.24
67 0.22
68 0.2
69 0.18
70 0.16
71 0.16
72 0.14
73 0.18
74 0.18
75 0.19
76 0.23
77 0.33
78 0.38
79 0.42
80 0.43
81 0.46
82 0.5
83 0.54
84 0.53
85 0.48
86 0.46
87 0.42
88 0.38
89 0.32
90 0.29
91 0.26
92 0.21
93 0.16
94 0.12
95 0.11
96 0.12
97 0.09
98 0.08
99 0.08
100 0.11
101 0.11
102 0.13
103 0.12
104 0.12
105 0.15
106 0.18
107 0.23
108 0.27
109 0.36
110 0.42
111 0.49
112 0.58
113 0.65
114 0.69
115 0.73
116 0.78
117 0.8
118 0.82
119 0.83
120 0.83
121 0.78
122 0.74
123 0.68
124 0.65
125 0.61
126 0.57