Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9VYW3

Protein Details
Accession A0A1L9VYW3    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-55MQNNGRKKEQRRRERRVVREKEEERREDGKENEGKRRKERKKKREKDENERMRDDBasic
NLS Segment(s)
PositionSequence
6-58RKKEQRRRERRVVREKEEERREDGKENEGKRRKERKKKREKDENERMRDDAKR
Subcellular Location(s) nucl 12, cyto 6, mito 4, plas 4
Family & Domain DBs
Amino Acid Sequences MQNNGRKKEQRRRERRVVREKEEERREDGKENEGKRRKERKKKREKDENERMRDDAKRNGETESKAASKRRAVCMVLPILATASCCSGRSSGDAASSSQHLKTVVWAVAFVHGMVGSGSGRPLPSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.93
4 0.92
5 0.88
6 0.88
7 0.85
8 0.84
9 0.82
10 0.74
11 0.7
12 0.64
13 0.59
14 0.54
15 0.49
16 0.47
17 0.46
18 0.47
19 0.51
20 0.55
21 0.58
22 0.62
23 0.71
24 0.74
25 0.78
26 0.85
27 0.86
28 0.89
29 0.93
30 0.94
31 0.94
32 0.93
33 0.92
34 0.92
35 0.91
36 0.86
37 0.77
38 0.67
39 0.59
40 0.54
41 0.47
42 0.43
43 0.38
44 0.34
45 0.32
46 0.33
47 0.33
48 0.29
49 0.27
50 0.23
51 0.2
52 0.21
53 0.23
54 0.24
55 0.27
56 0.3
57 0.33
58 0.33
59 0.32
60 0.31
61 0.32
62 0.3
63 0.25
64 0.21
65 0.16
66 0.13
67 0.12
68 0.11
69 0.07
70 0.08
71 0.07
72 0.08
73 0.09
74 0.09
75 0.1
76 0.13
77 0.14
78 0.13
79 0.15
80 0.15
81 0.15
82 0.16
83 0.17
84 0.16
85 0.14
86 0.14
87 0.13
88 0.12
89 0.14
90 0.17
91 0.17
92 0.15
93 0.15
94 0.14
95 0.16
96 0.16
97 0.14
98 0.1
99 0.08
100 0.08
101 0.08
102 0.08
103 0.06
104 0.06
105 0.07
106 0.08