Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9VI66

Protein Details
Accession A0A1L9VI66    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-61KTTTNRRTQRRECLKRTREREREREREKSSBasic
63-87EKGNEEAKKKENKKRPYPDSQTGNEHydrophilic
NLS Segment(s)
PositionSequence
45-77LKRTREREREREREKSSEEKGNEEAKKKENKKR
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MLVSGVRGKSRDGDRVVFEMEPSPSITQEKEKTTTNRRTQRRECLKRTREREREREREKSSEEKGNEEAKKKENKKRPYPDSQTGNERTTNAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.39
4 0.32
5 0.28
6 0.23
7 0.2
8 0.17
9 0.16
10 0.14
11 0.13
12 0.14
13 0.15
14 0.19
15 0.22
16 0.25
17 0.26
18 0.3
19 0.36
20 0.44
21 0.52
22 0.56
23 0.61
24 0.65
25 0.72
26 0.73
27 0.78
28 0.8
29 0.79
30 0.78
31 0.8
32 0.81
33 0.8
34 0.82
35 0.82
36 0.81
37 0.79
38 0.82
39 0.8
40 0.82
41 0.79
42 0.8
43 0.74
44 0.68
45 0.65
46 0.61
47 0.56
48 0.53
49 0.48
50 0.42
51 0.42
52 0.45
53 0.45
54 0.43
55 0.42
56 0.42
57 0.51
58 0.57
59 0.63
60 0.65
61 0.71
62 0.77
63 0.84
64 0.85
65 0.86
66 0.86
67 0.86
68 0.83
69 0.79
70 0.77
71 0.72
72 0.66
73 0.58