Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VBG1

Protein Details
Accession A0A1L9VBG1    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-39AMEKHNKPGKKGKNKTHDPYWWBasic
60-90PEYNPELRRKLKKERKERKQEAKEVEKRMRRBasic
NLS Segment(s)
PositionSequence
22-31HNKPGKKGKN
67-91RRKLKKERKERKQEAKEVEKRMRRE
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MAKAQEALERARSEVHAAMEKHNKPGKKGKNKTHDPYWWGYIDDGQGWTARPKSAYMKTPEYNPELRRKLKKERKERKQEAKEVEKRMRREWLEGSRVSKKVETG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.24
5 0.3
6 0.38
7 0.38
8 0.44
9 0.46
10 0.45
11 0.44
12 0.53
13 0.57
14 0.59
15 0.68
16 0.69
17 0.75
18 0.83
19 0.84
20 0.82
21 0.77
22 0.71
23 0.65
24 0.58
25 0.48
26 0.39
27 0.33
28 0.25
29 0.2
30 0.16
31 0.12
32 0.09
33 0.08
34 0.08
35 0.1
36 0.09
37 0.09
38 0.09
39 0.1
40 0.16
41 0.19
42 0.24
43 0.28
44 0.33
45 0.34
46 0.37
47 0.38
48 0.37
49 0.39
50 0.37
51 0.41
52 0.41
53 0.48
54 0.53
55 0.56
56 0.63
57 0.68
58 0.74
59 0.76
60 0.81
61 0.85
62 0.88
63 0.92
64 0.92
65 0.92
66 0.91
67 0.89
68 0.88
69 0.85
70 0.83
71 0.82
72 0.78
73 0.72
74 0.68
75 0.68
76 0.6
77 0.57
78 0.57
79 0.56
80 0.56
81 0.56
82 0.58
83 0.57
84 0.57
85 0.55