Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VN51

Protein Details
Accession A0A1L9VN51    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-48YNNPPLKPEIKQRKHKKNKPSSQRLFPFHydrophilic
NLS Segment(s)
PositionSequence
27-51KPEIKQRKHKKNKPSSQRLFPFGKN
Subcellular Location(s) mito_nucl 13.666, nucl 13.5, mito 12.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MQVIRIIQSCHRNGRDRSESYNNPPLKPEIKQRKHKKNKPSSQRLFPFGKNKEKELYRRRFCFFCSKDEARPKITKLFSLQNFVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.58
4 0.61
5 0.61
6 0.6
7 0.59
8 0.65
9 0.58
10 0.5
11 0.49
12 0.45
13 0.39
14 0.37
15 0.41
16 0.43
17 0.5
18 0.6
19 0.68
20 0.76
21 0.84
22 0.88
23 0.89
24 0.88
25 0.89
26 0.89
27 0.9
28 0.85
29 0.83
30 0.79
31 0.73
32 0.66
33 0.61
34 0.59
35 0.54
36 0.57
37 0.49
38 0.48
39 0.49
40 0.5
41 0.55
42 0.57
43 0.61
44 0.6
45 0.64
46 0.65
47 0.6
48 0.59
49 0.6
50 0.52
51 0.48
52 0.48
53 0.47
54 0.53
55 0.61
56 0.61
57 0.57
58 0.6
59 0.57
60 0.57
61 0.55
62 0.5
63 0.46
64 0.51
65 0.48