Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9VMI4

Protein Details
Accession A0A1L9VMI4    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27KASSVEKKSLRQKIYRRKTNLEKKLHEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences KASSVEKKSLRQKIYRRKTNLEKKLHEYSNICGADVSLGIRIRESGQVFIFADASGFWSFLSSQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.8
4 0.8
5 0.84
6 0.86
7 0.85
8 0.84
9 0.78
10 0.75
11 0.75
12 0.67
13 0.6
14 0.51
15 0.43
16 0.43
17 0.37
18 0.3
19 0.22
20 0.2
21 0.16
22 0.15
23 0.13
24 0.07
25 0.08
26 0.08
27 0.08
28 0.09
29 0.1
30 0.14
31 0.15
32 0.14
33 0.14
34 0.17
35 0.17
36 0.17
37 0.16
38 0.12
39 0.11
40 0.08
41 0.11
42 0.09
43 0.08
44 0.08
45 0.09