Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NWK4

Protein Details
Accession C0NWK4    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
73-100RWRLQEARFRKQSRQKRREYISQQNIPPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MAATVIRCVDVDEPVRGIELSSRRLATTTGFFQPSTCHYYGVSGDRERTSMAKQWPGEGGVRVRRPRGLVTFRWRLQEARFRKQSRQKRREYISQQNIPPYEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.16
4 0.15
5 0.16
6 0.17
7 0.19
8 0.22
9 0.22
10 0.22
11 0.22
12 0.23
13 0.2
14 0.2
15 0.2
16 0.2
17 0.21
18 0.21
19 0.2
20 0.21
21 0.23
22 0.25
23 0.22
24 0.19
25 0.17
26 0.19
27 0.21
28 0.23
29 0.23
30 0.17
31 0.19
32 0.18
33 0.19
34 0.18
35 0.17
36 0.15
37 0.17
38 0.19
39 0.22
40 0.22
41 0.23
42 0.23
43 0.23
44 0.22
45 0.18
46 0.19
47 0.21
48 0.27
49 0.28
50 0.29
51 0.29
52 0.3
53 0.32
54 0.36
55 0.35
56 0.36
57 0.42
58 0.5
59 0.5
60 0.52
61 0.5
62 0.45
63 0.45
64 0.47
65 0.47
66 0.48
67 0.56
68 0.56
69 0.64
70 0.73
71 0.77
72 0.79
73 0.82
74 0.82
75 0.83
76 0.86
77 0.87
78 0.86
79 0.86
80 0.85
81 0.84
82 0.77
83 0.75