Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9PTC9

Protein Details
Accession A0A1L9PTC9   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-110ALKADRERKKKASKVKKNRRKYRELEDGRTABasic
NLS Segment(s)
PositionSequence
82-102KADRERKKKASKVKKNRRKYR
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences LPPRLKLDDADITLSYLKGSGPGGQKINKTNSAVQLIHQPTGIVVKSQATRSRAQNEKYARQILADKVEQALRGDQSRVALKADRERKKKASKVKKNRRKYRELEDGRTAEEGEGEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.18
3 0.12
4 0.1
5 0.08
6 0.09
7 0.13
8 0.16
9 0.21
10 0.26
11 0.29
12 0.33
13 0.38
14 0.42
15 0.42
16 0.41
17 0.39
18 0.4
19 0.41
20 0.37
21 0.32
22 0.36
23 0.33
24 0.3
25 0.26
26 0.22
27 0.16
28 0.19
29 0.18
30 0.09
31 0.08
32 0.1
33 0.12
34 0.15
35 0.2
36 0.2
37 0.24
38 0.28
39 0.35
40 0.38
41 0.39
42 0.42
43 0.43
44 0.45
45 0.45
46 0.43
47 0.35
48 0.31
49 0.31
50 0.26
51 0.25
52 0.2
53 0.16
54 0.15
55 0.16
56 0.15
57 0.14
58 0.13
59 0.11
60 0.12
61 0.12
62 0.12
63 0.13
64 0.15
65 0.15
66 0.15
67 0.16
68 0.18
69 0.27
70 0.36
71 0.43
72 0.47
73 0.54
74 0.61
75 0.68
76 0.74
77 0.75
78 0.77
79 0.79
80 0.85
81 0.89
82 0.91
83 0.92
84 0.95
85 0.93
86 0.92
87 0.88
88 0.86
89 0.86
90 0.84
91 0.8
92 0.78
93 0.71
94 0.63
95 0.56
96 0.47
97 0.35
98 0.28