Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9PCF0

Protein Details
Accession A0A1L9PCF0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-49ALAKKHVPIVKKRTKRFFRHQSDRFKCVPESWRKPKGIDNRVRRRFKSHydrophilic
NLS Segment(s)
PositionSequence
12-17KKRTKR
34-46RKPKGIDNRVRRR
Subcellular Location(s) mito 18.5, mito_nucl 11.333, cyto 5.5, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MALAKKHVPIVKKRTKRFFRHQSDRFKCVPESWRKPKGIDNRVRRRFKSNIPMPSIGYGSNKKTRHMMPSGHKAFLVHNAKDVELLLMHNRTYAAEIASAVSSRKRVDIIAKAKALGVKVTNPRGRVTTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.87
4 0.88
5 0.89
6 0.89
7 0.9
8 0.89
9 0.89
10 0.86
11 0.83
12 0.74
13 0.67
14 0.58
15 0.52
16 0.53
17 0.52
18 0.56
19 0.59
20 0.64
21 0.63
22 0.63
23 0.66
24 0.67
25 0.67
26 0.66
27 0.68
28 0.7
29 0.78
30 0.83
31 0.78
32 0.74
33 0.69
34 0.68
35 0.68
36 0.64
37 0.62
38 0.6
39 0.59
40 0.52
41 0.48
42 0.4
43 0.3
44 0.26
45 0.21
46 0.2
47 0.26
48 0.26
49 0.26
50 0.29
51 0.3
52 0.32
53 0.33
54 0.35
55 0.34
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.34
63 0.34
64 0.23
65 0.25
66 0.25
67 0.25
68 0.24
69 0.24
70 0.15
71 0.09
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.1
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.08
88 0.09
89 0.11
90 0.12
91 0.13
92 0.13
93 0.14
94 0.2
95 0.29
96 0.34
97 0.39
98 0.4
99 0.39
100 0.39
101 0.39
102 0.34
103 0.28
104 0.23
105 0.23
106 0.3
107 0.4
108 0.42
109 0.42
110 0.44
111 0.43