Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9PQ35

Protein Details
Accession A0A1L9PQ35   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-73QWEERKRTGKARERRRKRCRPEDEGKRQVABasic
NLS Segment(s)
PositionSequence
27-27K
47-101ERKRTGKARERRRKRCRPEDEGKRQVASQKDRHQAVMREKERRGKRALGRGRSSG
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MMSGPFSQPRGKCRKMVLERLPTAGRKRGRQVEGEKPTASEAMQWEERKRTGKARERRRKRCRPEDEGKRQVASQKDRHQAVMREKERRGKRALGRGRSSGGTGSGRVSAWRAALKLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.64
3 0.71
4 0.71
5 0.71
6 0.69
7 0.68
8 0.65
9 0.59
10 0.55
11 0.52
12 0.48
13 0.44
14 0.51
15 0.55
16 0.54
17 0.57
18 0.59
19 0.62
20 0.63
21 0.61
22 0.53
23 0.44
24 0.42
25 0.34
26 0.28
27 0.19
28 0.14
29 0.14
30 0.19
31 0.2
32 0.21
33 0.24
34 0.27
35 0.28
36 0.29
37 0.32
38 0.37
39 0.45
40 0.53
41 0.61
42 0.69
43 0.77
44 0.86
45 0.89
46 0.9
47 0.91
48 0.92
49 0.89
50 0.87
51 0.87
52 0.87
53 0.86
54 0.83
55 0.75
56 0.65
57 0.57
58 0.52
59 0.49
60 0.45
61 0.43
62 0.44
63 0.49
64 0.49
65 0.51
66 0.52
67 0.51
68 0.54
69 0.56
70 0.53
71 0.54
72 0.56
73 0.62
74 0.64
75 0.63
76 0.59
77 0.57
78 0.59
79 0.63
80 0.69
81 0.69
82 0.67
83 0.65
84 0.63
85 0.55
86 0.48
87 0.39
88 0.33
89 0.26
90 0.21
91 0.19
92 0.18
93 0.17
94 0.17
95 0.18
96 0.16
97 0.17
98 0.19