Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9P7M3

Protein Details
Accession A0A1L9P7M3    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
58-77KTPSCPKPNLLKLKMKQRGQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 9.5, cyto 8.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
IPR027179  MTCP1  
Pfam View protein in Pfam  
PF08991  MTCP1  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MGGLKEDIAFDPPCHPRACAIQACLTKNSYQEEKCQAQINALYECCNAFYEQKGDDAKTPSCPKPNLLKLKMKQRGQET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.24
4 0.29
5 0.35
6 0.32
7 0.31
8 0.35
9 0.39
10 0.4
11 0.4
12 0.35
13 0.29
14 0.28
15 0.29
16 0.28
17 0.25
18 0.27
19 0.32
20 0.32
21 0.33
22 0.34
23 0.3
24 0.26
25 0.27
26 0.24
27 0.19
28 0.17
29 0.16
30 0.12
31 0.12
32 0.11
33 0.1
34 0.09
35 0.08
36 0.1
37 0.12
38 0.12
39 0.16
40 0.17
41 0.17
42 0.2
43 0.23
44 0.23
45 0.28
46 0.34
47 0.35
48 0.4
49 0.41
50 0.42
51 0.49
52 0.57
53 0.6
54 0.62
55 0.67
56 0.68
57 0.77
58 0.82
59 0.77