Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9P6T3

Protein Details
Accession A0A1L9P6T3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
82-111DSYSFPSPVKRARKKGQTRRGRGEKKEELVHydrophilic
NLS Segment(s)
PositionSequence
90-107VKRARKKGQTRRGRGEKK
Subcellular Location(s) extr 10, cyto 6, plas 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MVALPSRGQCGTVLVHGGWASDFVVPAPESPFSVLVVGGLALLALTEWGVMDGAPTALLASNSCRGISNRSSEHNAIKKDRDSYSFPSPVKRARKKGQTRRGRGEKKEELV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.14
4 0.14
5 0.11
6 0.1
7 0.09
8 0.07
9 0.07
10 0.06
11 0.08
12 0.08
13 0.09
14 0.1
15 0.1
16 0.1
17 0.11
18 0.12
19 0.1
20 0.1
21 0.09
22 0.07
23 0.06
24 0.06
25 0.04
26 0.03
27 0.03
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.05
48 0.08
49 0.08
50 0.09
51 0.1
52 0.1
53 0.15
54 0.18
55 0.22
56 0.22
57 0.25
58 0.3
59 0.31
60 0.38
61 0.39
62 0.41
63 0.4
64 0.41
65 0.41
66 0.41
67 0.41
68 0.39
69 0.38
70 0.39
71 0.43
72 0.46
73 0.44
74 0.45
75 0.47
76 0.52
77 0.57
78 0.61
79 0.63
80 0.65
81 0.75
82 0.81
83 0.87
84 0.89
85 0.9
86 0.9
87 0.91
88 0.93
89 0.91
90 0.88
91 0.88