Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9P6K2

Protein Details
Accession A0A1L9P6K2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
401-420CSYMRCQRWKIKPKETYTGSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000073  AB_hydrolase_1  
IPR013595  Pept_S33_TAP-like_C  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF00561  Abhydrolase_1  
PF08386  Abhydrolase_4  
Amino Acid Sequences MILFRTLLSTFAILATAECSINWKPCNPREFDSSALPVPFQCGTLDVPFDYTSRNGTEKLKLKLLKAPAPLKSKGTILFNMGGPGVNNRVDFSGLAPTFIPLTGGQYDLVIFDTRGTADTIPFSCYDDPAEEFQSFLNMVPSNESDTSVGELWARAAADAEACLEHSAKNGSVLTTAFVARDLMSVVDALGEDGLLRYWGLSYGTTLGATVAAMFPDRLDKVILDAVQNVHEYYHAKANFEEWEVSDESFFDIFAECVKAGPERCPLAAQNKTAEEYEAAAYELLEMVKYQPIPVGKLVLDYSTAKNIYASSLYSPRSWALTTTLVDIVMFGADTPLDAVIGTSPANITIENAPGLIAGDISLTGIYCSDNQRRTESLDDFTPVIDQLYDTSRIMGDLGVCSYMRCQRWKIKPKETYTGSFEHIQTRKPLLVIGNTLDGHTPLKSAYNTSSIFEGSSVLELDGNGHGSTAVPSECGLKAISAYWVNGTLPENGTRCPRDVEPFTKDWWPEVFKAAGVNKTWIKESGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.08
6 0.13
7 0.15
8 0.22
9 0.24
10 0.3
11 0.38
12 0.45
13 0.52
14 0.53
15 0.55
16 0.55
17 0.57
18 0.54
19 0.5
20 0.48
21 0.44
22 0.39
23 0.35
24 0.28
25 0.27
26 0.24
27 0.19
28 0.15
29 0.13
30 0.15
31 0.17
32 0.19
33 0.16
34 0.17
35 0.18
36 0.18
37 0.18
38 0.16
39 0.17
40 0.19
41 0.21
42 0.21
43 0.25
44 0.33
45 0.38
46 0.42
47 0.48
48 0.48
49 0.48
50 0.52
51 0.55
52 0.53
53 0.54
54 0.55
55 0.55
56 0.57
57 0.58
58 0.54
59 0.49
60 0.45
61 0.41
62 0.39
63 0.33
64 0.31
65 0.31
66 0.28
67 0.27
68 0.24
69 0.2
70 0.16
71 0.16
72 0.16
73 0.15
74 0.15
75 0.15
76 0.15
77 0.16
78 0.15
79 0.14
80 0.2
81 0.18
82 0.18
83 0.18
84 0.17
85 0.17
86 0.16
87 0.16
88 0.07
89 0.11
90 0.11
91 0.12
92 0.11
93 0.11
94 0.11
95 0.1
96 0.11
97 0.08
98 0.08
99 0.07
100 0.08
101 0.08
102 0.09
103 0.1
104 0.09
105 0.09
106 0.13
107 0.13
108 0.14
109 0.14
110 0.16
111 0.15
112 0.15
113 0.16
114 0.15
115 0.16
116 0.17
117 0.2
118 0.16
119 0.16
120 0.15
121 0.15
122 0.14
123 0.12
124 0.12
125 0.1
126 0.11
127 0.13
128 0.14
129 0.16
130 0.16
131 0.17
132 0.14
133 0.14
134 0.16
135 0.14
136 0.13
137 0.1
138 0.09
139 0.09
140 0.09
141 0.09
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.05
149 0.05
150 0.06
151 0.06
152 0.06
153 0.07
154 0.09
155 0.08
156 0.1
157 0.1
158 0.1
159 0.11
160 0.11
161 0.1
162 0.1
163 0.1
164 0.08
165 0.08
166 0.08
167 0.07
168 0.07
169 0.07
170 0.05
171 0.05
172 0.05
173 0.05
174 0.04
175 0.04
176 0.04
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.04
187 0.05
188 0.05
189 0.05
190 0.07
191 0.07
192 0.07
193 0.07
194 0.06
195 0.06
196 0.06
197 0.05
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.06
204 0.06
205 0.07
206 0.07
207 0.07
208 0.08
209 0.1
210 0.11
211 0.09
212 0.1
213 0.1
214 0.11
215 0.11
216 0.1
217 0.08
218 0.08
219 0.09
220 0.09
221 0.15
222 0.15
223 0.15
224 0.15
225 0.16
226 0.17
227 0.17
228 0.16
229 0.1
230 0.12
231 0.12
232 0.12
233 0.11
234 0.09
235 0.09
236 0.08
237 0.08
238 0.05
239 0.05
240 0.04
241 0.05
242 0.06
243 0.05
244 0.05
245 0.06
246 0.07
247 0.08
248 0.1
249 0.13
250 0.13
251 0.14
252 0.15
253 0.16
254 0.21
255 0.24
256 0.23
257 0.22
258 0.22
259 0.23
260 0.22
261 0.2
262 0.14
263 0.11
264 0.1
265 0.08
266 0.08
267 0.06
268 0.06
269 0.05
270 0.05
271 0.04
272 0.04
273 0.03
274 0.04
275 0.06
276 0.06
277 0.06
278 0.08
279 0.08
280 0.1
281 0.11
282 0.12
283 0.1
284 0.11
285 0.12
286 0.1
287 0.11
288 0.11
289 0.12
290 0.13
291 0.13
292 0.12
293 0.12
294 0.12
295 0.11
296 0.1
297 0.1
298 0.09
299 0.13
300 0.15
301 0.15
302 0.16
303 0.15
304 0.16
305 0.16
306 0.14
307 0.13
308 0.14
309 0.15
310 0.16
311 0.15
312 0.14
313 0.13
314 0.12
315 0.09
316 0.06
317 0.05
318 0.03
319 0.03
320 0.03
321 0.03
322 0.03
323 0.03
324 0.03
325 0.03
326 0.03
327 0.03
328 0.04
329 0.04
330 0.04
331 0.04
332 0.05
333 0.05
334 0.05
335 0.06
336 0.07
337 0.08
338 0.08
339 0.08
340 0.08
341 0.07
342 0.08
343 0.06
344 0.04
345 0.03
346 0.03
347 0.03
348 0.04
349 0.03
350 0.03
351 0.03
352 0.04
353 0.04
354 0.06
355 0.12
356 0.19
357 0.24
358 0.26
359 0.29
360 0.31
361 0.34
362 0.37
363 0.34
364 0.31
365 0.27
366 0.27
367 0.24
368 0.22
369 0.19
370 0.13
371 0.11
372 0.08
373 0.07
374 0.07
375 0.09
376 0.12
377 0.11
378 0.12
379 0.11
380 0.11
381 0.12
382 0.11
383 0.09
384 0.07
385 0.07
386 0.08
387 0.08
388 0.08
389 0.11
390 0.17
391 0.2
392 0.23
393 0.29
394 0.38
395 0.49
396 0.6
397 0.67
398 0.71
399 0.76
400 0.79
401 0.82
402 0.77
403 0.72
404 0.65
405 0.59
406 0.51
407 0.47
408 0.42
409 0.41
410 0.38
411 0.35
412 0.35
413 0.35
414 0.33
415 0.29
416 0.31
417 0.25
418 0.26
419 0.26
420 0.23
421 0.24
422 0.23
423 0.23
424 0.2
425 0.19
426 0.17
427 0.14
428 0.13
429 0.09
430 0.13
431 0.13
432 0.16
433 0.18
434 0.23
435 0.23
436 0.24
437 0.25
438 0.21
439 0.2
440 0.18
441 0.16
442 0.1
443 0.1
444 0.1
445 0.09
446 0.09
447 0.08
448 0.1
449 0.09
450 0.11
451 0.09
452 0.09
453 0.08
454 0.09
455 0.1
456 0.1
457 0.09
458 0.08
459 0.09
460 0.12
461 0.12
462 0.13
463 0.12
464 0.1
465 0.11
466 0.12
467 0.16
468 0.15
469 0.15
470 0.15
471 0.17
472 0.17
473 0.18
474 0.19
475 0.18
476 0.18
477 0.23
478 0.23
479 0.25
480 0.32
481 0.32
482 0.33
483 0.34
484 0.35
485 0.38
486 0.44
487 0.49
488 0.49
489 0.48
490 0.5
491 0.52
492 0.49
493 0.44
494 0.42
495 0.4
496 0.35
497 0.37
498 0.34
499 0.28
500 0.34
501 0.35
502 0.34
503 0.31
504 0.36
505 0.35
506 0.37
507 0.38
508 0.34