Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C0NSZ1

Protein Details
Accession C0NSZ1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-45VFLLPKPKIKHKHNHKHEPLBasic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 13, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MTWTPYPAATKQGRAPASLQMVMGWVFLLPKPKIKHKHNHKHEPLISPDHTPVPLCRVPEAGASVPKSVQPWVRAKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.36
4 0.36
5 0.32
6 0.27
7 0.19
8 0.19
9 0.17
10 0.15
11 0.1
12 0.06
13 0.05
14 0.06
15 0.12
16 0.12
17 0.18
18 0.21
19 0.3
20 0.39
21 0.46
22 0.55
23 0.61
24 0.71
25 0.75
26 0.83
27 0.8
28 0.8
29 0.77
30 0.71
31 0.63
32 0.58
33 0.49
34 0.4
35 0.36
36 0.28
37 0.25
38 0.22
39 0.18
40 0.19
41 0.2
42 0.19
43 0.19
44 0.19
45 0.2
46 0.21
47 0.24
48 0.2
49 0.23
50 0.23
51 0.24
52 0.23
53 0.23
54 0.22
55 0.23
56 0.26
57 0.28