Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9P9J2

Protein Details
Accession A0A1L9P9J2    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
35-54TPATGEKRGRGRPRKFPVGSBasic
56-77PVRPEGPKRGRGRPRKDPSGTIBasic
NLS Segment(s)
PositionSequence
40-72EKRGRGRPRKFPVGSTPVRPEGPKRGRGRPRKD
91-100GKGRGRPKKI
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR002740  EVE_domain  
IPR000116  HMGA  
IPR000637  HMGI/Y_DNA-bd_CS  
IPR015947  PUA-like_sf  
IPR047197  THYN1-like_EVE  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
PF01878  EVE  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
CDD cd21133  EVE  
Amino Acid Sequences MALGRKRKSESVSVADKAATPSKKVATDTATTPETPATGEKRGRGRPRKFPVGSTPVRPEGPKRGRGRPRKDPSGTIFFEPITTPKSTTPGKGRGRPKKISGASDSTPKSKPPTTATDDNTDDESARSYWLMKAEPESRMEKGKDVKFSIDDLRVAKEPEPWDGVRNPVAKKHMQTMRKGDLAFFYHSNCKVPGIAGVMEIVQEHSPDESAFDPSHPYYDEKSKRENPKWVVVHVEFRRKFDHLITLHELKSHATAKSPLENLQMLNQTRLSVSSVSPKEWDFIMSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.41
4 0.36
5 0.37
6 0.31
7 0.26
8 0.29
9 0.32
10 0.35
11 0.36
12 0.36
13 0.33
14 0.34
15 0.34
16 0.35
17 0.33
18 0.29
19 0.28
20 0.24
21 0.2
22 0.18
23 0.2
24 0.19
25 0.24
26 0.27
27 0.32
28 0.4
29 0.49
30 0.59
31 0.65
32 0.69
33 0.72
34 0.78
35 0.83
36 0.77
37 0.73
38 0.71
39 0.7
40 0.66
41 0.62
42 0.58
43 0.52
44 0.52
45 0.48
46 0.43
47 0.45
48 0.48
49 0.51
50 0.51
51 0.58
52 0.66
53 0.75
54 0.8
55 0.8
56 0.81
57 0.82
58 0.8
59 0.76
60 0.73
61 0.71
62 0.63
63 0.54
64 0.46
65 0.36
66 0.32
67 0.26
68 0.22
69 0.16
70 0.15
71 0.14
72 0.14
73 0.19
74 0.2
75 0.25
76 0.3
77 0.37
78 0.43
79 0.5
80 0.59
81 0.65
82 0.71
83 0.72
84 0.69
85 0.69
86 0.66
87 0.63
88 0.57
89 0.53
90 0.46
91 0.48
92 0.45
93 0.39
94 0.36
95 0.32
96 0.32
97 0.29
98 0.31
99 0.28
100 0.33
101 0.36
102 0.42
103 0.43
104 0.43
105 0.42
106 0.4
107 0.37
108 0.3
109 0.23
110 0.17
111 0.15
112 0.1
113 0.09
114 0.08
115 0.07
116 0.08
117 0.1
118 0.1
119 0.09
120 0.13
121 0.16
122 0.17
123 0.19
124 0.2
125 0.19
126 0.23
127 0.23
128 0.22
129 0.27
130 0.29
131 0.29
132 0.28
133 0.28
134 0.25
135 0.27
136 0.26
137 0.2
138 0.19
139 0.16
140 0.17
141 0.17
142 0.17
143 0.15
144 0.17
145 0.16
146 0.16
147 0.19
148 0.17
149 0.19
150 0.19
151 0.21
152 0.21
153 0.25
154 0.24
155 0.24
156 0.28
157 0.28
158 0.29
159 0.35
160 0.37
161 0.38
162 0.43
163 0.46
164 0.47
165 0.47
166 0.46
167 0.38
168 0.34
169 0.32
170 0.29
171 0.23
172 0.2
173 0.22
174 0.23
175 0.24
176 0.21
177 0.19
178 0.16
179 0.16
180 0.15
181 0.13
182 0.12
183 0.1
184 0.1
185 0.09
186 0.09
187 0.09
188 0.08
189 0.06
190 0.06
191 0.06
192 0.06
193 0.06
194 0.06
195 0.08
196 0.07
197 0.1
198 0.1
199 0.11
200 0.14
201 0.14
202 0.16
203 0.16
204 0.17
205 0.18
206 0.28
207 0.36
208 0.36
209 0.45
210 0.52
211 0.61
212 0.66
213 0.72
214 0.67
215 0.69
216 0.68
217 0.61
218 0.6
219 0.51
220 0.54
221 0.51
222 0.57
223 0.48
224 0.48
225 0.5
226 0.44
227 0.44
228 0.37
229 0.4
230 0.31
231 0.36
232 0.4
233 0.4
234 0.38
235 0.38
236 0.36
237 0.28
238 0.31
239 0.28
240 0.22
241 0.21
242 0.25
243 0.27
244 0.34
245 0.35
246 0.32
247 0.33
248 0.34
249 0.32
250 0.33
251 0.37
252 0.32
253 0.32
254 0.3
255 0.27
256 0.25
257 0.25
258 0.22
259 0.16
260 0.17
261 0.24
262 0.26
263 0.27
264 0.29
265 0.29
266 0.28
267 0.26