Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9P2V0

Protein Details
Accession A0A1L9P2V0    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
34-58YTSFRYSRLRIKRHQSRPRKYPGGVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, cyto_nucl 8.5, nucl 7.5, mito 6, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026891  Fn3-like  
IPR036881  Glyco_hydro_3_C_sf  
IPR013783  Ig-like_fold  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF14310  Fn3-like  
Amino Acid Sequences MGGSNFSEGVYVDYRRFDKERINPRYEFGFGLSYTSFRYSRLRIKRHQSRPRKYPGGVVVPGGQDDLWDIVATVTCEVQNTGSVAGAEAAQLYVGIPGAPVRQLRGFQKPEIRPGKTAKVTFNLTRRDLSVWDPAAQKWLLQPGDYSVWVGSSSRKLPLQGVLHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.29
4 0.29
5 0.35
6 0.42
7 0.52
8 0.56
9 0.6
10 0.56
11 0.56
12 0.57
13 0.49
14 0.41
15 0.32
16 0.26
17 0.2
18 0.21
19 0.19
20 0.16
21 0.16
22 0.18
23 0.16
24 0.16
25 0.2
26 0.23
27 0.32
28 0.41
29 0.47
30 0.52
31 0.63
32 0.72
33 0.78
34 0.84
35 0.85
36 0.85
37 0.86
38 0.88
39 0.84
40 0.74
41 0.69
42 0.65
43 0.61
44 0.51
45 0.43
46 0.36
47 0.29
48 0.28
49 0.21
50 0.15
51 0.08
52 0.07
53 0.07
54 0.05
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.02
83 0.02
84 0.03
85 0.04
86 0.06
87 0.06
88 0.08
89 0.1
90 0.13
91 0.17
92 0.25
93 0.28
94 0.3
95 0.39
96 0.39
97 0.47
98 0.52
99 0.51
100 0.47
101 0.48
102 0.53
103 0.5
104 0.51
105 0.45
106 0.42
107 0.45
108 0.46
109 0.48
110 0.46
111 0.42
112 0.4
113 0.38
114 0.35
115 0.32
116 0.29
117 0.3
118 0.26
119 0.27
120 0.28
121 0.26
122 0.28
123 0.27
124 0.24
125 0.19
126 0.24
127 0.21
128 0.2
129 0.21
130 0.2
131 0.23
132 0.23
133 0.22
134 0.14
135 0.14
136 0.15
137 0.15
138 0.15
139 0.17
140 0.19
141 0.23
142 0.25
143 0.26
144 0.28
145 0.35